Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QAY59_RS02535 | Genome accession | NZ_CP122487 |
| Coordinates | 501443..501868 (+) | Length | 141 a.a. |
| NCBI ID | WP_015978401.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain IT-MRSA45 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 493945..536462 | 501443..501868 | within | 0 |
Gene organization within MGE regions
Location: 493945..536462
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QAY59_RS02465 (QAY59_02465) | - | 493945..495330 (-) | 1386 | WP_000861313.1 | recombinase family protein | - |
| QAY59_RS02470 (QAY59_02470) | - | 495536..496216 (-) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| QAY59_RS02475 (QAY59_02475) | - | 496248..496973 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| QAY59_RS02480 (QAY59_02480) | - | 497001..497675 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QAY59_RS02485 (QAY59_02485) | - | 497692..498024 (-) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| QAY59_RS02490 (QAY59_02490) | - | 498287..498481 (+) | 195 | WP_000108122.1 | multiprotein-bridging factor 1 family protein | - |
| QAY59_RS02495 (QAY59_02495) | - | 498481..499245 (+) | 765 | WP_001002760.1 | phage antirepressor Ant | - |
| QAY59_RS02500 (QAY59_02500) | - | 499262..499456 (+) | 195 | WP_103146357.1 | hypothetical protein | - |
| QAY59_RS02505 (QAY59_02505) | - | 499487..499690 (+) | 204 | Protein_497 | hypothetical protein | - |
| QAY59_RS02510 (QAY59_02510) | - | 499658..499903 (-) | 246 | WP_000122245.1 | hypothetical protein | - |
| QAY59_RS02515 (QAY59_02515) | - | 500083..500244 (+) | 162 | WP_000066025.1 | DUF1270 domain-containing protein | - |
| QAY59_RS02520 (QAY59_02520) | - | 500336..500596 (+) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| QAY59_RS02525 (QAY59_02525) | - | 500606..500827 (+) | 222 | WP_000815403.1 | DUF2483 family protein | - |
| QAY59_RS02530 (QAY59_02530) | - | 500820..501443 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| QAY59_RS02535 (QAY59_02535) | ssbA | 501443..501868 (+) | 426 | WP_015978401.1 | single-stranded DNA-binding protein | Machinery gene |
| QAY59_RS02540 (QAY59_02540) | - | 501879..502430 (+) | 552 | WP_001004506.1 | NUMOD4 domain-containing protein | - |
| QAY59_RS02545 (QAY59_02545) | - | 502431..503105 (+) | 675 | WP_103146356.1 | putative HNHc nuclease | - |
| QAY59_RS02550 (QAY59_02550) | - | 503211..504068 (-) | 858 | WP_000371250.1 | DUF4393 domain-containing protein | - |
| QAY59_RS02555 (QAY59_02555) | - | 504133..504903 (+) | 771 | WP_000190224.1 | conserved phage C-terminal domain-containing protein | - |
| QAY59_RS02560 (QAY59_02560) | - | 504913..505692 (+) | 780 | WP_000803065.1 | ATP-binding protein | - |
| QAY59_RS02565 (QAY59_02565) | - | 505686..505847 (+) | 162 | WP_000237153.1 | hypothetical protein | - |
| QAY59_RS02570 (QAY59_02570) | - | 505860..506081 (+) | 222 | WP_001123673.1 | DUF3269 family protein | - |
| QAY59_RS02575 (QAY59_02575) | - | 506092..506496 (+) | 405 | WP_000049804.1 | DUF1064 domain-containing protein | - |
| QAY59_RS02580 (QAY59_02580) | - | 506501..506686 (+) | 186 | WP_001187234.1 | DUF3113 family protein | - |
| QAY59_RS02585 (QAY59_02585) | - | 506687..507046 (+) | 360 | WP_000029370.1 | SA1788 family PVL leukocidin-associated protein | - |
| QAY59_RS02590 (QAY59_02590) | - | 507047..507295 (+) | 249 | WP_031873670.1 | SAV1978 family virulence-associated passenger protein | - |
| QAY59_RS02595 (QAY59_02595) | - | 507310..507552 (+) | 243 | WP_001065066.1 | DUF1024 family protein | - |
| QAY59_RS02600 (QAY59_02600) | - | 507552..507758 (+) | 207 | WP_000097971.1 | Lar family restriction alleviation protein | - |
| QAY59_RS02605 (QAY59_02605) | - | 507751..508281 (+) | 531 | WP_000185706.1 | dUTPase | - |
| QAY59_RS02610 (QAY59_02610) | - | 508318..508563 (+) | 246 | WP_000120373.1 | hypothetical protein | - |
| QAY59_RS02615 (QAY59_02615) | - | 508560..508748 (+) | 189 | WP_000195802.1 | DUF1381 domain-containing protein | - |
| QAY59_RS02620 (QAY59_02620) | - | 508723..508923 (+) | 201 | WP_001125015.1 | hypothetical protein | - |
| QAY59_RS02625 (QAY59_02625) | rinB | 508926..509099 (+) | 174 | WP_001806316.1 | transcriptional activator RinB | - |
| QAY59_RS02630 (QAY59_02630) | - | 509100..509501 (+) | 402 | WP_000286968.1 | hypothetical protein | - |
| QAY59_RS02635 (QAY59_02635) | - | 509854..510348 (+) | 495 | WP_000594088.1 | terminase small subunit | - |
| QAY59_RS02640 (QAY59_02640) | - | 510341..511564 (+) | 1224 | WP_001037578.1 | PBSX family phage terminase large subunit | - |
| QAY59_RS02645 (QAY59_02645) | - | 511561..512985 (+) | 1425 | WP_000177422.1 | phage portal protein | - |
| QAY59_RS02650 (QAY59_02650) | - | 512954..513907 (+) | 954 | WP_000184133.1 | phage head morphogenesis protein | - |
| QAY59_RS02655 (QAY59_02655) | - | 513909..514115 (+) | 207 | WP_000346033.1 | hypothetical protein | - |
| QAY59_RS02660 (QAY59_02660) | - | 514218..514802 (+) | 585 | WP_001019219.1 | DUF4355 domain-containing protein | - |
| QAY59_RS02665 (QAY59_02665) | - | 514819..515733 (+) | 915 | WP_000235168.1 | phage major capsid protein | - |
| QAY59_RS02670 (QAY59_02670) | - | 515745..515888 (+) | 144 | WP_000002931.1 | hypothetical protein | - |
| QAY59_RS02675 (QAY59_02675) | - | 515894..516244 (+) | 351 | WP_000177351.1 | phage head-tail adapter protein | - |
| QAY59_RS02680 (QAY59_02680) | - | 516256..516591 (+) | 336 | WP_000483041.1 | phage head closure protein | - |
| QAY59_RS02685 (QAY59_02685) | - | 516578..516991 (+) | 414 | WP_001151330.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QAY59_RS02690 (QAY59_02690) | - | 517004..517429 (+) | 426 | WP_000270192.1 | DUF3168 domain-containing protein | - |
| QAY59_RS02695 (QAY59_02695) | - | 517430..517987 (+) | 558 | WP_000057582.1 | tail protein | - |
| QAY59_RS02700 (QAY59_02700) | - | 518054..518560 (+) | 507 | WP_000134337.1 | tail assembly chaperone | - |
| QAY59_RS02705 (QAY59_02705) | - | 518605..518889 (+) | 285 | WP_000880587.1 | hypothetical protein | - |
| QAY59_RS02710 | - | 518893..519091 (+) | 199 | Protein_538 | hypothetical protein | - |
| QAY59_RS02715 (QAY59_02710) | - | 519199..522036 (+) | 2838 | WP_375640863.1 | terminase | - |
| QAY59_RS02720 (QAY59_02715) | - | 522051..522992 (+) | 942 | WP_111015181.1 | phage tail domain-containing protein | - |
| QAY59_RS02725 (QAY59_02720) | - | 523003..524889 (+) | 1887 | WP_001122001.1 | SGNH/GDSL hydrolase family protein | - |
| QAY59_RS02730 (QAY59_02725) | - | 524902..526800 (+) | 1899 | WP_103146355.1 | hypothetical protein | - |
| QAY59_RS02735 (QAY59_02730) | - | 526800..528623 (+) | 1824 | WP_103146354.1 | phage baseplate upper protein | - |
| QAY59_RS02740 (QAY59_02735) | - | 528623..529000 (+) | 378 | WP_000705921.1 | DUF2977 domain-containing protein | - |
| QAY59_RS02745 (QAY59_02740) | - | 529004..529177 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| QAY59_RS02750 (QAY59_02745) | - | 529218..529517 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| QAY59_RS02755 (QAY59_02750) | - | 529654..531528 (+) | 1875 | WP_000524040.1 | glucosaminidase domain-containing protein | - |
| QAY59_RS02760 (QAY59_02755) | - | 531541..532713 (+) | 1173 | WP_000276647.1 | BppU family phage baseplate upper protein | - |
| QAY59_RS02765 (QAY59_02760) | - | 532719..533114 (+) | 396 | WP_000398863.1 | hypothetical protein | - |
| QAY59_RS02770 (QAY59_02765) | - | 533170..533607 (+) | 438 | WP_000354119.1 | phage holin | - |
| QAY59_RS02775 (QAY59_02770) | - | 533588..535033 (+) | 1446 | WP_031864827.1 | SH3 domain-containing protein | - |
| QAY59_RS02780 (QAY59_02775) | - | 535423..536010 (+) | 588 | WP_000448197.1 | hypothetical protein | - |
| QAY59_RS02785 (QAY59_02780) | - | 536007..536462 (+) | 456 | WP_000971220.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15947.45 Da Isoelectric Point: 5.8790
>NTDB_id=815917 QAY59_RS02535 WP_015978401.1 501443..501868(+) (ssbA) [Staphylococcus aureus strain IT-MRSA45]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=815917 QAY59_RS02535 WP_015978401.1 501443..501868(+) (ssbA) [Staphylococcus aureus strain IT-MRSA45]
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
74.576 |
83.688 |
0.624 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.603 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
75.177 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.553 |
100 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
41.844 |
100 |
0.418 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.763 |
83.688 |
0.383 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.763 |
83.688 |
0.383 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.915 |
83.688 |
0.376 |