Detailed information NTG0812729

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: QA593_RS06630
• Genome accession: NZ_CP121522
• Coordinates: 1392175..1392492 (+)
• Length: 105 a.a.
• NCBI ID: WP_001831271.1
• Uniprot ID: A0A9Q5JKE9
• Organism: Staphylococcus epidermidis strain 1DSE05
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1387175..1397492

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QA593_RS06600	-	1387952..1388152 (+)	201	WP_001831138.1	YqgQ family protein	-
QA593_RS06605	-	1388152..1389138 (+)	987	WP_001831113.1	ROK family glucokinase	-
QA593_RS06610	-	1389138..1389464 (+)	327	WP_001831234.1	MTH1187 family thiamine-binding protein	-
QA593_RS06615	-	1389464..1390087 (+)	624	WP_001831016.1	MBL fold metallo-hydrolase	-
QA593_RS06620	comGA	1390144..1391118 (+)	975	WP_001831109.1	competence type IV pilus ATPase ComGA	Machinery gene
QA593_RS06625	comGB	1391090..1392157 (+)	1068	WP_001831131.1	competence type IV pilus assembly protein ComGB	Machinery gene
QA593_RS06630	comGC	1392175..1392492 (+)	318	WP_001831271.1	competence type IV pilus major pilin ComGC	Machinery gene
QA593_RS06635	comGD	1392482..1392919 (+)	438	WP_001831025.1	competence type IV pilus minor pilin ComGD	-
QA593_RS06640	-	1392906..1393199 (+)	294	WP_001831116.1	hypothetical protein	-
QA593_RS06645	-	1393123..1393614 (+)	492	WP_002440043.1	competence type IV pilus minor pilin ComGF	-
QA593_RS06650	-	1393779..1394291 (+)	513	WP_002485736.1	shikimate kinase	-
QA593_RS06655	gcvT	1394509..1395600 (+)	1092	WP_049392313.1	glycine cleavage system aminomethyltransferase GcvT	-
QA593_RS06660	gcvPA	1395620..1396966 (+)	1347	WP_049392315.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11491.58 Da
• Isoelectric Point: 9.7429

>NTDB_id=812729 QA593_RS06630 WP_001831271.1 1392175..1392492(+) (comGC) [Staphylococcus epidermidis strain 1DSE05]
MKTLKLLKKTRAFTLIEMLLVLLIISLLLILIIPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRNPSNIDDLVSDG
FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=812729 QA593_RS06630 WP_001831271.1 1392175..1392492(+) (comGC) [Staphylococcus epidermidis strain 1DSE05]
ATGAAAACATTGAAATTATTGAAAAAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATAAGTTT
ATTGTTAATACTTATAATTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA
TGGTAAACAGTCAAATAGAAGCCTACGCTTTAAAACATAATCGCAACCCTTCTAATATTGATGATTTGGTTTCAGATGGT
TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATTAGTATTGCAAATGGAGAAGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	87.255	97.143	0.848
comGC	Staphylococcus aureus N315	87.255	97.143	0.848
comGC/cglC	Streptococcus mitis SK321	44.66	98.095	0.438
comGC/cglC	Streptococcus pneumoniae TIGR4	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae D39	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae R6	44.681	89.524	0.4
comYC	Streptococcus mutans UA159	47.674	81.905	0.39
comYC	Streptococcus mutans UA140	47.674	81.905	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	46.512	81.905	0.381
comGC	Lactococcus lactis subsp. cremoris KW2	47.561	78.095	0.371
comGC/cglC	Streptococcus mitis NCTC 12261	50	74.286	0.371
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	86.667	0.362