Detailed information NTG0811462

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: P8632_RS07140
• Genome accession: NZ_CP121263
• Coordinates: 1365236..1365547 (+)
• Length: 103 a.a.
• NCBI ID: WP_002449700.1
• Uniprot ID: -
• Organism: Staphylococcus hominis strain FSEL1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1360236..1370547

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P8632_RS07105 (P8632_07095)	-	1360584..1360715 (+)	132	WP_256947140.1	hypothetical protein	-
P8632_RS07110 (P8632_07100)	-	1361411..1361608 (+)	198	WP_326514891.1	hypothetical protein	-
P8632_RS07115 (P8632_07105)	-	1361605..1362012 (-)	408	WP_326514892.1	TIR domain-containing protein	-
P8632_RS07120 (P8632_07110)	-	1362006..1362488 (-)	483	WP_326514893.1	DUF4231 domain-containing protein	-
P8632_RS07125 (P8632_07115)	-	1362539..1362940 (-)	402	WP_311051649.1	sporulation protein	-
P8632_RS07130 (P8632_07120)	-	1363504..1364181 (+)	678	Protein_1367	ATPase, T2SS/T4P/T4SS family	-
P8632_RS07135 (P8632_07125)	comGB	1364153..1365217 (+)	1065	WP_002455292.1	competence type IV pilus assembly protein ComGB	-
P8632_RS07140 (P8632_07130)	comGC	1365236..1365547 (+)	312	WP_002449700.1	competence type IV pilus major pilin ComGC	Machinery gene
P8632_RS07145 (P8632_07135)	comGD	1365537..1365971 (+)	435	WP_002449773.1	competence type IV pilus minor pilin ComGD	-
P8632_RS07150 (P8632_07140)	-	1366163..1366660 (+)	498	WP_002449908.1	competence protein ComG	-
P8632_RS07155 (P8632_07145)	-	1366825..1367334 (+)	510	WP_064207489.1	shikimate kinase	-
P8632_RS07160 (P8632_07150)	gcvT	1367526..1368617 (+)	1092	WP_002488553.1	glycine cleavage system aminomethyltransferase GcvT	-
P8632_RS07165 (P8632_07155)	gcvPA	1368634..1369986 (+)	1353	WP_002455298.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11420.60 Da
• Isoelectric Point: 9.7125

>NTDB_id=811462 P8632_RS07140 WP_002449700.1 1365236..1365547(+) (comGC) [Staphylococcus hominis strain FSEL1]
MKKFKHKLKAFTLIEMLLVLLIISVLLILIIPNIAKQMAHIQSTGCEAQVKMVNSQIEAYTLKHNRVPNSIENLITEGFI
KQGQSSCKSGETISIKNGEAVAE

Nucleotide

• Length: 312 bp

>NTDB_id=811462 P8632_RS07140 WP_002449700.1 1365236..1365547(+) (comGC) [Staphylococcus hominis strain FSEL1]
ATGAAAAAATTCAAACATAAATTAAAAGCTTTTACTTTAATCGAGATGTTACTTGTACTATTAATAATTAGTGTTTTACT
CATTCTTATTATTCCAAACATAGCTAAACAAATGGCACATATTCAATCAACAGGATGTGAAGCACAAGTGAAAATGGTCA
ATAGTCAAATTGAAGCTTATACTTTAAAACATAATAGAGTTCCTAATTCTATTGAGAACTTAATAACTGAAGGGTTTATA
AAACAAGGGCAATCATCTTGTAAGTCTGGAGAAACTATCAGTATTAAAAATGGAGAAGCAGTTGCAGAGTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (7-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	80.392	99.029	0.796
comGC	Staphylococcus aureus MW2	80.392	99.029	0.796
comGC/cglC	Streptococcus mitis SK321	46.875	93.204	0.437
comGC/cglC	Streptococcus pneumoniae R6	45.833	93.204	0.427
comGC/cglC	Streptococcus pneumoniae TIGR4	45.833	93.204	0.427
comGC/cglC	Streptococcus pneumoniae Rx1	45.833	93.204	0.427
comGC/cglC	Streptococcus pneumoniae D39	45.833	93.204	0.427
comYC	Streptococcus mutans UA159	47.191	86.408	0.408
comYC	Streptococcus mutans UA140	47.191	86.408	0.408
comGC	Bacillus subtilis subsp. subtilis str. 168	43.158	92.233	0.398
comYC	Streptococcus gordonii str. Challis substr. CH1	46.591	85.437	0.398
comGC/cglC	Streptococcus mitis NCTC 12261	48.193	80.583	0.388
comYC	Streptococcus suis isolate S10	45.349	83.495	0.379
comGC	Lactococcus lactis subsp. cremoris KW2	48.718	75.728	0.369