Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | P4831_RS11785 | Genome accession | NZ_CP120842 |
| Coordinates | 2275283..2275552 (-) | Length | 89 a.a. |
| NCBI ID | WP_023349160.1 | Uniprot ID | A0AB35KDE0 |
| Organism | Lactococcus lactis strain ZFM559 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2266627..2317601 | 2275283..2275552 | within | 0 |
Gene organization within MGE regions
Location: 2266627..2317601
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4831_RS11720 | - | 2266627..2267262 (-) | 636 | WP_012898614.1 | DUF421 domain-containing protein | - |
| P4831_RS11725 | - | 2267279..2267710 (-) | 432 | WP_010906308.1 | DUF3290 domain-containing protein | - |
| P4831_RS11730 | - | 2267824..2268201 (-) | 378 | WP_003129983.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| P4831_RS11735 | - | 2268406..2269272 (+) | 867 | WP_010906309.1 | RluA family pseudouridine synthase | - |
| P4831_RS11745 | - | 2270819..2271628 (-) | 810 | WP_010906310.1 | metal ABC transporter permease | - |
| P4831_RS11750 | - | 2271621..2272358 (-) | 738 | WP_277812508.1 | metal ABC transporter ATP-binding protein | - |
| P4831_RS11755 | - | 2272535..2273377 (-) | 843 | WP_015427160.1 | metal ABC transporter substrate-binding protein | - |
| P4831_RS11760 | - | 2273374..2273811 (-) | 438 | WP_010906313.1 | zinc-dependent MarR family transcriptional regulator | - |
| P4831_RS11765 | comGG | 2273892..2274176 (-) | 285 | WP_010906314.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| P4831_RS11770 | comGF | 2274215..2274661 (-) | 447 | WP_031558968.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| P4831_RS11775 | comGE | 2274624..2274920 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| P4831_RS11780 | comGD | 2274892..2275308 (-) | 417 | WP_225509978.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| P4831_RS11785 | comGC | 2275283..2275552 (-) | 270 | WP_023349160.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| P4831_RS11795 | - | 2275952..2276017 (-) | 66 | WP_228762923.1 | hypothetical protein | - |
| P4831_RS11800 | - | 2276385..2277164 (-) | 780 | WP_058220347.1 | peptidoglycan amidohydrolase family protein | - |
| P4831_RS11805 | - | 2277164..2277451 (-) | 288 | WP_023164507.1 | phage holin | - |
| P4831_RS11810 | - | 2277464..2277814 (-) | 351 | WP_277812509.1 | hypothetical protein | - |
| P4831_RS11815 | - | 2277827..2278057 (-) | 231 | WP_058213223.1 | hypothetical protein | - |
| P4831_RS11820 | - | 2278071..2282150 (-) | 4080 | WP_277812510.1 | hypothetical protein | - |
| P4831_RS11825 | - | 2282150..2283676 (-) | 1527 | WP_277812511.1 | distal tail protein Dit | - |
| P4831_RS11830 | - | 2283690..2286293 (-) | 2604 | WP_277812512.1 | phage tail tape measure protein | - |
| P4831_RS11835 | - | 2286283..2286990 (-) | 708 | WP_003131324.1 | Gp15 family bacteriophage protein | - |
| P4831_RS11840 | - | 2287006..2287413 (-) | 408 | WP_003131323.1 | hypothetical protein | - |
| P4831_RS11845 | - | 2287470..2287946 (-) | 477 | WP_014570559.1 | hypothetical protein | - |
| P4831_RS11850 | - | 2287957..2288391 (-) | 435 | WP_143459400.1 | minor capsid protein | - |
| P4831_RS11855 | - | 2288391..2288720 (-) | 330 | WP_003131320.1 | hypothetical protein | - |
| P4831_RS11860 | - | 2288717..2289061 (-) | 345 | WP_014570557.1 | putative minor capsid protein | - |
| P4831_RS11865 | - | 2289051..2289452 (-) | 402 | WP_014570556.1 | hypothetical protein | - |
| P4831_RS11870 | - | 2289525..2289761 (-) | 237 | WP_014570555.1 | Ig-like domain-containing protein | - |
| P4831_RS11875 | - | 2289790..2290263 (-) | 474 | WP_277812513.1 | hypothetical protein | - |
| P4831_RS11880 | - | 2290260..2290706 (-) | 447 | WP_277812514.1 | hypothetical protein | - |
| P4831_RS11885 | - | 2290721..2291770 (-) | 1050 | WP_277812515.1 | XkdF-like putative serine protease domain-containing protein | - |
| P4831_RS11890 | - | 2291786..2292616 (-) | 831 | WP_031561053.1 | phage minor head protein | - |
| P4831_RS11895 | - | 2292609..2294138 (-) | 1530 | WP_277812516.1 | phage portal protein | - |
| P4831_RS11900 | terL | 2294151..2295602 (-) | 1452 | WP_277812517.1 | phage terminase large subunit | - |
| P4831_RS11905 | - | 2295583..2296056 (-) | 474 | WP_277812518.1 | helix-turn-helix domain-containing protein | - |
| P4831_RS11910 | - | 2296426..2296848 (-) | 423 | WP_010905372.1 | RinA family protein | - |
| P4831_RS11915 | - | 2297376..2297690 (-) | 315 | WP_277812519.1 | hypothetical protein | - |
| P4831_RS11920 | - | 2297687..2297872 (-) | 186 | WP_277812520.1 | hypothetical protein | - |
| P4831_RS11925 | - | 2297918..2298271 (-) | 354 | WP_211753253.1 | hypothetical protein | - |
| P4831_RS11930 | - | 2298272..2298436 (-) | 165 | WP_259750140.1 | DUF1660 domain-containing protein | - |
| P4831_RS11935 | - | 2298433..2298663 (-) | 231 | WP_240819248.1 | hypothetical protein | - |
| P4831_RS11940 | - | 2298710..2298883 (-) | 174 | WP_032941801.1 | hypothetical protein | - |
| P4831_RS11945 | - | 2298880..2299251 (-) | 372 | WP_240733496.1 | hypothetical protein | - |
| P4831_RS11950 | - | 2299392..2299790 (-) | 399 | WP_240733498.1 | hypothetical protein | - |
| P4831_RS11955 | dut | 2299793..2300212 (-) | 420 | WP_240733499.1 | dUTP diphosphatase | - |
| P4831_RS11960 | - | 2300209..2300793 (-) | 585 | WP_240733500.1 | DUF1642 domain-containing protein | - |
| P4831_RS11965 | - | 2300786..2301145 (-) | 360 | WP_211752511.1 | hypothetical protein | - |
| P4831_RS11970 | - | 2301337..2301543 (-) | 207 | WP_277812521.1 | hypothetical protein | - |
| P4831_RS11975 | - | 2301651..2302061 (-) | 411 | WP_251921186.1 | hypothetical protein | - |
| P4831_RS11980 | - | 2302074..2302316 (-) | 243 | WP_251921187.1 | L-rhamnose isomerase | - |
| P4831_RS11985 | - | 2302309..2303235 (-) | 927 | WP_251921188.1 | phage replisome organizer N-terminal domain-containing protein | - |
| P4831_RS11990 | - | 2303499..2304425 (-) | 927 | WP_277812522.1 | RecT family recombinase | - |
| P4831_RS11995 | - | 2304422..2305255 (-) | 834 | WP_251921190.1 | hypothetical protein | - |
| P4831_RS12000 | - | 2305358..2305534 (-) | 177 | WP_032950010.1 | putative transcriptional regulator | - |
| P4831_RS12005 | - | 2305531..2305779 (-) | 249 | WP_211752881.1 | hypothetical protein | - |
| P4831_RS12010 | - | 2305792..2305914 (-) | 123 | WP_277812523.1 | hypothetical protein | - |
| P4831_RS12015 | - | 2305911..2306093 (-) | 183 | WP_251921191.1 | hypothetical protein | - |
| P4831_RS12020 | - | 2306109..2306822 (-) | 714 | WP_277812524.1 | Rha family transcriptional regulator | - |
| P4831_RS12025 | - | 2306868..2307074 (-) | 207 | WP_153927607.1 | helix-turn-helix transcriptional regulator | - |
| P4831_RS12030 | - | 2307234..2307635 (+) | 402 | WP_153927608.1 | helix-turn-helix transcriptional regulator | - |
| P4831_RS12035 | - | 2307647..2308246 (+) | 600 | WP_277812525.1 | hypothetical protein | - |
| P4831_RS12040 | - | 2308327..2308866 (+) | 540 | WP_251921194.1 | PH domain-containing protein | - |
| P4831_RS12045 | - | 2308986..2310449 (+) | 1464 | WP_277812526.1 | recombinase family protein | - |
| P4831_RS12050 | - | 2310446..2310586 (-) | 141 | WP_023164653.1 | hypothetical protein | - |
| P4831_RS12055 | comGB | 2310600..2311673 (-) | 1074 | WP_010906319.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| P4831_RS12060 | comGA | 2311567..2312505 (-) | 939 | WP_031561106.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| P4831_RS12065 | - | 2312625..2317541 (-) | 4917 | WP_043994851.1 | PolC-type DNA polymerase III | - |
Sequence
Protein
Download Length: 89 a.a. Molecular weight: 10113.52 Da Isoelectric Point: 4.2950
>NTDB_id=808798 P4831_RS11785 WP_023349160.1 2275283..2275552(-) (comGC) [Lactococcus lactis strain ZFM559]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLSELLSAGMITQKQISAYDNYYDQN
KNEERNFND
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLSELLSAGMITQKQISAYDNYYDQN
KNEERNFND
Nucleotide
Download Length: 270 bp
>NTDB_id=808798 P4831_RS11785 WP_023349160.1 2275283..2275552(-) (comGC) [Lactococcus lactis strain ZFM559]
ATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTCAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGTCAGAATTGCTCAGTGCAGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAT
AAAAATGAAGAACGAAATTTTAATGACTAA
ATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTCAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGTCAGAATTGCTCAGTGCAGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAT
AAAAATGAAGAACGAAATTTTAATGACTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Lactococcus lactis subsp. cremoris KW2 |
88 |
84.27 |
0.742 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
57.647 |
95.506 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae D39 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae R6 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
55.056 |
100 |
0.551 |
| comYC | Streptococcus suis isolate S10 |
58.904 |
82.022 |
0.483 |
| comGC/cglC | Streptococcus mitis SK321 |
55.263 |
85.393 |
0.472 |
| comYC | Streptococcus mutans UA140 |
52.055 |
82.022 |
0.427 |
| comYC | Streptococcus mutans UA159 |
52.055 |
82.022 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
57.812 |
71.91 |
0.416 |