Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   P4831_RS11780 Genome accession   NZ_CP120842
Coordinates   2274892..2275308 (-) Length   138 a.a.
NCBI ID   WP_225509978.1    Uniprot ID   -
Organism   Lactococcus lactis strain ZFM559     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2266627..2317601 2274892..2275308 within 0


Gene organization within MGE regions


Location: 2266627..2317601
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P4831_RS11720 - 2266627..2267262 (-) 636 WP_012898614.1 DUF421 domain-containing protein -
  P4831_RS11725 - 2267279..2267710 (-) 432 WP_010906308.1 DUF3290 domain-containing protein -
  P4831_RS11730 - 2267824..2268201 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  P4831_RS11735 - 2268406..2269272 (+) 867 WP_010906309.1 RluA family pseudouridine synthase -
  P4831_RS11745 - 2270819..2271628 (-) 810 WP_010906310.1 metal ABC transporter permease -
  P4831_RS11750 - 2271621..2272358 (-) 738 WP_277812508.1 metal ABC transporter ATP-binding protein -
  P4831_RS11755 - 2272535..2273377 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  P4831_RS11760 - 2273374..2273811 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  P4831_RS11765 comGG 2273892..2274176 (-) 285 WP_010906314.1 competence type IV pilus minor pilin ComGG Machinery gene
  P4831_RS11770 comGF 2274215..2274661 (-) 447 WP_031558968.1 competence type IV pilus minor pilin ComGF Machinery gene
  P4831_RS11775 comGE 2274624..2274920 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  P4831_RS11780 comGD 2274892..2275308 (-) 417 WP_225509978.1 competence type IV pilus minor pilin ComGD Machinery gene
  P4831_RS11785 comGC 2275283..2275552 (-) 270 WP_023349160.1 competence type IV pilus major pilin ComGC Machinery gene
  P4831_RS11795 - 2275952..2276017 (-) 66 WP_228762923.1 hypothetical protein -
  P4831_RS11800 - 2276385..2277164 (-) 780 WP_058220347.1 peptidoglycan amidohydrolase family protein -
  P4831_RS11805 - 2277164..2277451 (-) 288 WP_023164507.1 phage holin -
  P4831_RS11810 - 2277464..2277814 (-) 351 WP_277812509.1 hypothetical protein -
  P4831_RS11815 - 2277827..2278057 (-) 231 WP_058213223.1 hypothetical protein -
  P4831_RS11820 - 2278071..2282150 (-) 4080 WP_277812510.1 hypothetical protein -
  P4831_RS11825 - 2282150..2283676 (-) 1527 WP_277812511.1 distal tail protein Dit -
  P4831_RS11830 - 2283690..2286293 (-) 2604 WP_277812512.1 phage tail tape measure protein -
  P4831_RS11835 - 2286283..2286990 (-) 708 WP_003131324.1 Gp15 family bacteriophage protein -
  P4831_RS11840 - 2287006..2287413 (-) 408 WP_003131323.1 hypothetical protein -
  P4831_RS11845 - 2287470..2287946 (-) 477 WP_014570559.1 hypothetical protein -
  P4831_RS11850 - 2287957..2288391 (-) 435 WP_143459400.1 minor capsid protein -
  P4831_RS11855 - 2288391..2288720 (-) 330 WP_003131320.1 hypothetical protein -
  P4831_RS11860 - 2288717..2289061 (-) 345 WP_014570557.1 putative minor capsid protein -
  P4831_RS11865 - 2289051..2289452 (-) 402 WP_014570556.1 hypothetical protein -
  P4831_RS11870 - 2289525..2289761 (-) 237 WP_014570555.1 Ig-like domain-containing protein -
  P4831_RS11875 - 2289790..2290263 (-) 474 WP_277812513.1 hypothetical protein -
  P4831_RS11880 - 2290260..2290706 (-) 447 WP_277812514.1 hypothetical protein -
  P4831_RS11885 - 2290721..2291770 (-) 1050 WP_277812515.1 XkdF-like putative serine protease domain-containing protein -
  P4831_RS11890 - 2291786..2292616 (-) 831 WP_031561053.1 phage minor head protein -
  P4831_RS11895 - 2292609..2294138 (-) 1530 WP_277812516.1 phage portal protein -
  P4831_RS11900 terL 2294151..2295602 (-) 1452 WP_277812517.1 phage terminase large subunit -
  P4831_RS11905 - 2295583..2296056 (-) 474 WP_277812518.1 helix-turn-helix domain-containing protein -
  P4831_RS11910 - 2296426..2296848 (-) 423 WP_010905372.1 RinA family protein -
  P4831_RS11915 - 2297376..2297690 (-) 315 WP_277812519.1 hypothetical protein -
  P4831_RS11920 - 2297687..2297872 (-) 186 WP_277812520.1 hypothetical protein -
  P4831_RS11925 - 2297918..2298271 (-) 354 WP_211753253.1 hypothetical protein -
  P4831_RS11930 - 2298272..2298436 (-) 165 WP_259750140.1 DUF1660 domain-containing protein -
  P4831_RS11935 - 2298433..2298663 (-) 231 WP_240819248.1 hypothetical protein -
  P4831_RS11940 - 2298710..2298883 (-) 174 WP_032941801.1 hypothetical protein -
  P4831_RS11945 - 2298880..2299251 (-) 372 WP_240733496.1 hypothetical protein -
  P4831_RS11950 - 2299392..2299790 (-) 399 WP_240733498.1 hypothetical protein -
  P4831_RS11955 dut 2299793..2300212 (-) 420 WP_240733499.1 dUTP diphosphatase -
  P4831_RS11960 - 2300209..2300793 (-) 585 WP_240733500.1 DUF1642 domain-containing protein -
  P4831_RS11965 - 2300786..2301145 (-) 360 WP_211752511.1 hypothetical protein -
  P4831_RS11970 - 2301337..2301543 (-) 207 WP_277812521.1 hypothetical protein -
  P4831_RS11975 - 2301651..2302061 (-) 411 WP_251921186.1 hypothetical protein -
  P4831_RS11980 - 2302074..2302316 (-) 243 WP_251921187.1 L-rhamnose isomerase -
  P4831_RS11985 - 2302309..2303235 (-) 927 WP_251921188.1 phage replisome organizer N-terminal domain-containing protein -
  P4831_RS11990 - 2303499..2304425 (-) 927 WP_277812522.1 RecT family recombinase -
  P4831_RS11995 - 2304422..2305255 (-) 834 WP_251921190.1 hypothetical protein -
  P4831_RS12000 - 2305358..2305534 (-) 177 WP_032950010.1 putative transcriptional regulator -
  P4831_RS12005 - 2305531..2305779 (-) 249 WP_211752881.1 hypothetical protein -
  P4831_RS12010 - 2305792..2305914 (-) 123 WP_277812523.1 hypothetical protein -
  P4831_RS12015 - 2305911..2306093 (-) 183 WP_251921191.1 hypothetical protein -
  P4831_RS12020 - 2306109..2306822 (-) 714 WP_277812524.1 Rha family transcriptional regulator -
  P4831_RS12025 - 2306868..2307074 (-) 207 WP_153927607.1 helix-turn-helix transcriptional regulator -
  P4831_RS12030 - 2307234..2307635 (+) 402 WP_153927608.1 helix-turn-helix transcriptional regulator -
  P4831_RS12035 - 2307647..2308246 (+) 600 WP_277812525.1 hypothetical protein -
  P4831_RS12040 - 2308327..2308866 (+) 540 WP_251921194.1 PH domain-containing protein -
  P4831_RS12045 - 2308986..2310449 (+) 1464 WP_277812526.1 recombinase family protein -
  P4831_RS12050 - 2310446..2310586 (-) 141 WP_023164653.1 hypothetical protein -
  P4831_RS12055 comGB 2310600..2311673 (-) 1074 WP_010906319.1 competence type IV pilus assembly protein ComGB Machinery gene
  P4831_RS12060 comGA 2311567..2312505 (-) 939 WP_031561106.1 competence type IV pilus ATPase ComGA Machinery gene
  P4831_RS12065 - 2312625..2317541 (-) 4917 WP_043994851.1 PolC-type DNA polymerase III -

Sequence


Protein


Download         Length: 138 a.a.        Molecular weight: 15890.64 Da        Isoelectric Point: 7.9826

>NTDB_id=808797 P4831_RS11780 WP_225509978.1 2274892..2275308(-) (comGD) [Lactococcus lactis strain ZFM559]
MKNEILMTKAFTLLESLLVLLITSFITTLFSLEIIQTIHLFKGELFVLQFENFYKRSQEDAALLQKSESLVAKNQELICE
DRSITIPKEVAVKDFTVKFDDKGENSSLQKLTISLPYEKKFITYQLEIGSGKFKKKIS

Nucleotide


Download         Length: 417 bp        

>NTDB_id=808797 P4831_RS11780 WP_225509978.1 2274892..2275308(-) (comGD) [Lactococcus lactis strain ZFM559]
ATGAAGAACGAAATTTTAATGACTAAAGCATTTACTTTACTAGAGTCTCTTCTAGTTTTGTTGATTACTTCTTTTATCAC
AACTCTTTTTTCTTTAGAAATAATACAAACAATCCATCTTTTTAAGGGAGAATTGTTTGTTCTTCAATTTGAAAATTTCT
ATAAAAGGAGTCAAGAAGATGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTAAAAATCAAGAATTAATCTGTGAA
GATAGAAGTATCACAATTCCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTTGATGATAAGGGAGAGAATTCTAG
CTTACAAAAACTCACAATTTCTTTACCTTACGAAAAAAAGTTCATCACTTATCAATTGGAGATAGGCAGTGGAAAATTTA
AAAAGAAAATCAGTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Lactococcus lactis subsp. cremoris KW2

65.942

100

0.659

  comYD Streptococcus gordonii str. Challis substr. CH1

40.458

94.928

0.384

  comYD Streptococcus mutans UA140

41.406

92.754

0.384

  comYD Streptococcus mutans UA159

41.406

92.754

0.384