NTDB

Overview

Name	ssbA	Type	Machinery gene
Locus tag	P3L36_RS01535	Genome accession	NZ_CP120654
Coordinates	245357..245752 (+)	Length	131 a.a.
NCBI ID	WP_000282447.1	Uniprot ID	A0AAV3JLT6
Organism	Streptococcus agalactiae strain Guangzhou-SAG036
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 240357..250752

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P3L36_RS01500 (P3L36_01500)	proC	240751..241521 (-)	771	WP_001869147.1	pyrroline-5-carboxylate reductase	-
P3L36_RS01505 (P3L36_01505)	pepA	241591..242658 (-)	1068	WP_001281321.1	glutamyl aminopeptidase	-
P3L36_RS01510 (P3L36_01510)	-	242843..243082 (-)	240	WP_000660177.1	hypothetical protein	-
P3L36_RS01515 (P3L36_01515)	-	243243..243527 (+)	285	WP_000791273.1	DUF4651 domain-containing protein	-
P3L36_RS01520 (P3L36_01520)	-	243524..243847 (+)	324	WP_000602780.1	thioredoxin family protein	-
P3L36_RS01525 (P3L36_01525)	ytpR	243880..244506 (+)	627	WP_000578325.1	YtpR family tRNA-binding protein	-
P3L36_RS01530 (P3L36_01530)	-	244560..245276 (-)	717	WP_000186176.1	class I SAM-dependent methyltransferase	-
P3L36_RS01535 (P3L36_01535)	ssbA	245357..245752 (+)	396	WP_000282447.1	single-stranded DNA-binding protein	Machinery gene
P3L36_RS01540 (P3L36_01540)	-	245876..246520 (+)	645	WP_000416617.1	HAD family hydrolase	-
P3L36_RS01545 (P3L36_01545)	-	246547..248292 (+)	1746	WP_000930332.1	LytS/YhcK type 5TM receptor domain-containing protein	-
P3L36_RS01550 (P3L36_01550)	-	248273..249013 (+)	741	WP_000697627.1	LytTR family transcriptional regulator DNA-binding domain-containing protein	-
P3L36_RS01555 (P3L36_01555)	-	249183..249638 (+)	456	WP_000683316.1	CidA/LrgA family protein	-
P3L36_RS01560 (P3L36_01560)	lrgB	249640..250368 (+)	729	WP_000421727.1	antiholin-like protein LrgB	-

Sequence

Protein

Download Length: 131 a.a. Molecular weight: 14774.80 Da Isoelectric Point: 7.0189

                                >NTDB_id=807513 P3L36_RS01535 WP_000282447.1 245357..245752(+) (ssbA) [Streptococcus agalactiae strain Guangzhou-SAG036]

MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETLASYGTKGSLISIDGELRTR

KYEKDGQTHYITEVLASSFQLLESRAQRAMRENNVSGDLSDLVLEEEELPF

Nucleotide

Download Length: 396 bp

                                >NTDB_id=807513 P3L36_RS01535 WP_000282447.1 245357..245752(+) (ssbA) [Streptococcus agalactiae strain Guangzhou-SAG036]

ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTAAC

GCGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT

GGGGTCGTCTAGCGGAAACCCTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAATAGATGGTGAATTGCGTACGCGC

AAGTACGAAAAGGATGGTCAAACGCACTATATCACTGAAGTATTAGCATCATCATTTCAGTTGTTAGAAAGCCGTGCCCA

ACGTGCTATGCGTGAAAATAATGTTTCTGGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-102)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbA	Streptococcus mutans UA159	80.916	100	0.809
ssbB/cilA	Streptococcus pneumoniae R6	77.863	100	0.779
ssbB/cilA	Streptococcus pneumoniae Rx1	77.863	100	0.779
ssbB/cilA	Streptococcus pneumoniae D39	77.863	100	0.779
ssbB/cilA	Streptococcus pneumoniae TIGR4	77.099	100	0.771
ssbB	Streptococcus sobrinus strain NIDR 6715-7	77.099	100	0.771
ssbB/cilA	Streptococcus mitis NCTC 12261	76.336	100	0.763
ssbB/cilA	Streptococcus mitis SK321	76.336	100	0.763
ssbB	Lactococcus lactis subsp. cremoris KW2	60.526	87.023	0.527
ssbA	Bacillus subtilis subsp. subtilis str. 168	50.943	80.916	0.412
ssb	Latilactobacillus sakei subsp. sakei 23K	46.018	86.26	0.397

Detailed information NTG0807513