Detailed information NTG0804219

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: P3U05_RS06010
• Genome accession: NZ_CP120179
• Coordinates: 1282293..1282616 (+)
• Length: 107 a.a.
• NCBI ID: WP_014613822.1
• Uniprot ID: -
• Organism: Staphylococcus pseudintermedius strain Dog018
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1277293..1287616

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P3U05_RS05980 (P3U05_05980)	-	1277969..1278172 (+)	204	WP_014613816.1	YqgQ family protein	-
P3U05_RS05985 (P3U05_05985)	-	1278169..1279155 (+)	987	WP_014613817.1	ROK family glucokinase	-
P3U05_RS05990 (P3U05_05990)	-	1279156..1279467 (+)	312	WP_014613818.1	MTH1187 family thiamine-binding protein	-
P3U05_RS05995 (P3U05_05995)	-	1279480..1280109 (+)	630	WP_014613819.1	MBL fold metallo-hydrolase	-
P3U05_RS06000 (P3U05_06000)	comGA	1280270..1281244 (+)	975	WP_014613820.1	competence type IV pilus ATPase ComGA	Machinery gene
P3U05_RS06005 (P3U05_06005)	comGB	1281213..1282280 (+)	1068	WP_014613821.1	competence type IV pilus assembly protein ComGB	-
P3U05_RS06010 (P3U05_06010)	comGC	1282293..1282616 (+)	324	WP_014613822.1	competence type IV pilus major pilin ComGC	Machinery gene
P3U05_RS06015 (P3U05_06015)	comGD	1282594..1283034 (+)	441	WP_014613823.1	competence type IV pilus minor pilin ComGD	-
P3U05_RS06020 (P3U05_06020)	-	1283139..1283339 (+)	201	WP_020219623.1	hypothetical protein	-
P3U05_RS06025 (P3U05_06025)	-	1283245..1283730 (+)	486	WP_080556831.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
P3U05_RS06030 (P3U05_06030)	-	1283894..1284421 (+)	528	WP_014613826.1	shikimate kinase	-
P3U05_RS06035 (P3U05_06035)	gcvT	1284579..1285670 (+)	1092	WP_014613827.1	glycine cleavage system aminomethyltransferase GcvT	-
P3U05_RS06040 (P3U05_06040)	gcvPA	1285683..1287032 (+)	1350	WP_014613828.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 12055.31 Da
• Isoelectric Point: 9.0966

>NTDB_id=804219 P3U05_RS06010 WP_014613822.1 1282293..1282616(+) (comGC) [Staphylococcus pseudintermedius strain Dog018]
MIQQLKLKFNKKKGFTLIEMLLVLLIISVLLILIIPNIAKQSDHIQKTGCVAQLKMVDSQIEAYALKFNHKPNTIDDLVR
EGYIKESQKTCKSGEEITIRDGEAVAS

Nucleotide

• Length: 324 bp

>NTDB_id=804219 P3U05_RS06010 WP_014613822.1 1282293..1282616(+) (comGC) [Staphylococcus pseudintermedius strain Dog018]
ATGATTCAACAACTTAAATTAAAATTCAACAAAAAGAAAGGTTTTACATTAATTGAAATGCTACTTGTTCTGTTAATTAT
TAGTGTACTATTGATTCTCATTATCCCGAATATTGCTAAGCAGTCAGATCATATCCAAAAAACGGGTTGTGTTGCACAAT
TAAAAATGGTCGATAGTCAAATAGAAGCCTATGCTTTAAAGTTTAACCACAAACCGAATACGATTGATGATTTAGTTCGT
GAAGGCTACATTAAAGAAAGTCAAAAAACATGCAAATCAGGTGAAGAGATCACAATCAGAGATGGCGAAGCAGTTGCGTC
ATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	73.529	95.327	0.701
comGC	Staphylococcus aureus N315	73.529	95.327	0.701
comGC/cglC	Streptococcus mitis SK321	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae D39	42.857	91.589	0.393
comGC/cglC	Streptococcus pneumoniae TIGR4	42.857	91.589	0.393
comGC/cglC	Streptococcus pneumoniae Rx1	42.857	91.589	0.393
comGC/cglC	Streptococcus pneumoniae R6	42.857	91.589	0.393
comYC	Streptococcus suis isolate S10	52.564	72.897	0.383
comGC	Bacillus subtilis subsp. subtilis str. 168	44.565	85.981	0.383
comYC	Streptococcus gordonii str. Challis substr. CH1	48.193	77.57	0.374
comGC/cglC	Streptococcus mitis NCTC 12261	47.561	76.636	0.364
comGC	Lactococcus lactis subsp. cremoris KW2	47.561	76.636	0.364