Detailed information NTG0802942

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: P3T86_RS07105
• Genome accession: NZ_CP120099
• Coordinates: 1477558..1477875 (+)
• Length: 105 a.a.
• NCBI ID: WP_115342135.1
• Uniprot ID: -
• Organism: Staphylococcus nepalensis strain Dog109
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1472558..1482875

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P3T86_RS07075 (P3T86_07075)	-	1473021..1473227 (+)	207	WP_103373744.1	YqgQ family protein	-
P3T86_RS07080 (P3T86_07080)	-	1473527..1474513 (+)	987	WP_096809499.1	glucokinase	-
P3T86_RS07085 (P3T86_07085)	-	1474513..1474839 (+)	327	WP_096809501.1	MTH1187 family thiamine-binding protein	-
P3T86_RS07090 (P3T86_07090)	-	1474839..1475462 (+)	624	WP_096809503.1	MBL fold metallo-hydrolase	-
P3T86_RS07095 (P3T86_07095)	comGA	1475524..1476498 (+)	975	WP_108909309.1	competence type IV pilus ATPase ComGA	Machinery gene
P3T86_RS07100 (P3T86_07100)	comGB	1476470..1477537 (+)	1068	WP_232164817.1	competence type IV pilus assembly protein ComGB	-
P3T86_RS07105 (P3T86_07105)	comGC	1477558..1477875 (+)	318	WP_115342135.1	competence type IV pilus major pilin ComGC	Machinery gene
P3T86_RS07110 (P3T86_07110)	comGD	1477865..1478305 (+)	441	WP_323701986.1	competence type IV pilus minor pilin ComGD	-
P3T86_RS07115 (P3T86_07115)	-	1478286..1478579 (+)	294	WP_115342137.1	hypothetical protein	-
P3T86_RS07120 (P3T86_07120)	-	1478557..1479000 (+)	444	WP_323701987.1	competence type IV pilus minor pilin ComGF	-
P3T86_RS07125 (P3T86_07125)	-	1479178..1479672 (+)	495	WP_369967663.1	shikimate kinase	-
P3T86_RS07130 (P3T86_07130)	gcvT	1479849..1480940 (+)	1092	WP_096809520.1	glycine cleavage system aminomethyltransferase GcvT	-
P3T86_RS07135 (P3T86_07135)	gcvPA	1480958..1482310 (+)	1353	WP_103372680.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11822.00 Da
• Isoelectric Point: 9.4266

>NTDB_id=802942 P3T86_RS07105 WP_115342135.1 1477558..1477875(+) (comGC) [Staphylococcus nepalensis strain Dog109]
MHKIKKLYNKKAFTLIEMLLVLLIISLLLILIIPNIAKQSSHIQSTGCEAQIKMVESQVEAYTLKHNKKPQSIEELISDG
YIKENQKYCKSGATIHISNGEVVAN

Nucleotide

• Length: 318 bp

>NTDB_id=802942 P3T86_RS07105 WP_115342135.1 1477558..1477875(+) (comGC) [Staphylococcus nepalensis strain Dog109]
ATGCATAAAATAAAAAAACTATACAATAAAAAAGCATTCACATTGATTGAAATGCTACTTGTTCTATTAATTATTAGTTT
ATTACTTATCCTTATTATACCTAATATCGCTAAACAATCATCACATATCCAAAGCACTGGTTGTGAAGCACAAATAAAAA
TGGTAGAAAGTCAAGTTGAAGCTTACACATTAAAACATAATAAAAAACCACAATCTATAGAGGAACTTATTTCAGATGGT
TATATCAAAGAAAATCAGAAATATTGTAAATCAGGTGCTACTATCCATATTAGTAACGGTGAAGTAGTTGCAAACTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	76.471	97.143	0.743
comGC	Staphylococcus aureus N315	76.471	97.143	0.743
comYC	Streptococcus mutans UA159	42.453	100	0.429
comYC	Streptococcus mutans UA140	42.453	100	0.429
comGC	Bacillus subtilis subsp. subtilis str. 168	45.745	89.524	0.41
comGC/cglC	Streptococcus pneumoniae R6	46.667	85.714	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	46.667	85.714	0.4
comGC/cglC	Streptococcus mitis SK321	46.667	85.714	0.4
comGC/cglC	Streptococcus pneumoniae D39	46.667	85.714	0.4
comYC	Streptococcus gordonii str. Challis substr. CH1	47.674	81.905	0.39
comGC/cglC	Streptococcus mitis NCTC 12261	51.316	72.381	0.371
comYC	Streptococcus suis isolate S10	50	72.381	0.362
comGC/cglC	Streptococcus pneumoniae TIGR4	50	72.381	0.362