Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | P3U31_RS07230 | Genome accession | NZ_CP120036 |
| Coordinates | 1519163..1519591 (-) | Length | 142 a.a. |
| NCBI ID | WP_000934385.1 | Uniprot ID | A0A2K0CLZ8 |
| Organism | Staphylococcus aureus strain Dog138 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1484776..1539627 | 1519163..1519591 | within | 0 |
Gene organization within MGE regions
Location: 1484776..1539627
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3U31_RS06990 (P3U31_06990) | - | 1484776..1484961 (-) | 186 | WP_000470336.1 | hypothetical protein | - |
| P3U31_RS06995 (P3U31_06995) | - | 1485170..1486180 (-) | 1011 | WP_016187751.1 | restriction endonuclease subunit S | - |
| P3U31_RS07000 (P3U31_07000) | - | 1486167..1488071 (-) | 1905 | WP_001003363.1 | HsdM family class I SAM-dependent methyltransferase | - |
| P3U31_RS07005 (P3U31_07005) | - | 1488673..1490127 (-) | 1455 | WP_016187869.1 | N-acetylmuramoyl-L-alanine amidase | - |
| P3U31_RS07010 (P3U31_07010) | - | 1490138..1490440 (-) | 303 | WP_000339145.1 | phage holin | - |
| P3U31_RS07015 (P3U31_07015) | - | 1490566..1490940 (-) | 375 | WP_000340978.1 | hypothetical protein | - |
| P3U31_RS07020 (P3U31_07020) | - | 1490996..1491283 (-) | 288 | WP_001040259.1 | hypothetical protein | - |
| P3U31_RS07025 (P3U31_07025) | - | 1491330..1491482 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| P3U31_RS07030 (P3U31_07030) | - | 1491472..1495257 (-) | 3786 | WP_320419576.1 | phage tail spike protein | - |
| P3U31_RS07035 (P3U31_07035) | - | 1495273..1496763 (-) | 1491 | WP_281344392.1 | phage distal tail protein | - |
| P3U31_RS07040 (P3U31_07040) | - | 1496763..1501412 (-) | 4650 | WP_103150091.1 | phage tail tape measure protein | - |
| P3U31_RS07045 (P3U31_07045) | gpGT | 1501468..1501590 (-) | 123 | WP_000570353.1 | phage tail assembly chaperone GT | - |
| P3U31_RS07050 (P3U31_07050) | gpG | 1501650..1502096 (-) | 447 | WP_000442601.1 | phage tail assembly chaperone G | - |
| P3U31_RS07055 (P3U31_07055) | - | 1502161..1503114 (-) | 954 | WP_000570652.1 | major tail protein | - |
| P3U31_RS07060 (P3U31_07060) | - | 1503115..1503495 (-) | 381 | WP_000611452.1 | hypothetical protein | - |
| P3U31_RS07065 (P3U31_07065) | - | 1503492..1503869 (-) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| P3U31_RS07070 (P3U31_07070) | - | 1503869..1504204 (-) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| P3U31_RS07075 (P3U31_07075) | - | 1504191..1504523 (-) | 333 | WP_001177486.1 | head-tail connector protein | - |
| P3U31_RS07080 (P3U31_07080) | - | 1504532..1504690 (-) | 159 | WP_001252099.1 | hypothetical protein | - |
| P3U31_RS07085 (P3U31_07085) | - | 1504726..1505973 (-) | 1248 | WP_000849950.1 | phage major capsid protein | - |
| P3U31_RS07090 (P3U31_07090) | - | 1506061..1506645 (-) | 585 | WP_070005644.1 | HK97 family phage prohead protease | - |
| P3U31_RS07095 (P3U31_07095) | - | 1506638..1507888 (-) | 1251 | WP_000511067.1 | phage portal protein | - |
| P3U31_RS07100 (P3U31_07100) | - | 1508108..1509802 (-) | 1695 | WP_000133304.1 | terminase large subunit | - |
| P3U31_RS07105 (P3U31_07105) | - | 1509805..1510272 (-) | 468 | WP_000919026.1 | phage terminase small subunit P27 family | - |
| P3U31_RS07110 (P3U31_07110) | - | 1510402..1510746 (-) | 345 | WP_000817289.1 | HNH endonuclease | - |
| P3U31_RS07115 (P3U31_07115) | - | 1510762..1511214 (-) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| P3U31_RS07120 (P3U31_07120) | - | 1511329..1511799 (-) | 471 | WP_070002574.1 | hypothetical protein | - |
| P3U31_RS07125 (P3U31_07125) | - | 1511822..1512022 (-) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| P3U31_RS07130 (P3U31_07130) | rinB | 1512022..1512171 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| P3U31_RS07135 (P3U31_07135) | - | 1512168..1512374 (-) | 207 | WP_000195759.1 | DUF1381 domain-containing protein | - |
| P3U31_RS07140 (P3U31_07140) | - | 1512391..1512564 (-) | 174 | WP_001209216.1 | hypothetical protein | - |
| P3U31_RS07145 (P3U31_07145) | - | 1512601..1513131 (-) | 531 | WP_031870213.1 | dUTPase | - |
| P3U31_RS07150 (P3U31_07150) | - | 1513124..1513294 (-) | 171 | WP_000714413.1 | hypothetical protein | - |
| P3U31_RS07155 (P3U31_07155) | - | 1513281..1513535 (-) | 255 | WP_017804684.1 | DUF1024 family protein | - |
| P3U31_RS07160 (P3U31_07160) | - | 1513528..1513893 (-) | 366 | WP_001624703.1 | hypothetical protein | - |
| P3U31_RS07165 (P3U31_07165) | - | 1513890..1514339 (-) | 450 | WP_000982708.1 | YopX family protein | - |
| P3U31_RS07170 (P3U31_07170) | - | 1514404..1514646 (-) | 243 | WP_015984514.1 | SAV1978 family virulence-associated passenger protein | - |
| P3U31_RS07175 (P3U31_07175) | - | 1514650..1515006 (-) | 357 | WP_000029376.1 | SA1788 family PVL leukocidin-associated protein | - |
| P3U31_RS07180 (P3U31_07180) | - | 1515134..1515439 (-) | 306 | WP_000101252.1 | hypothetical protein | - |
| P3U31_RS07185 (P3U31_07185) | - | 1515440..1515625 (-) | 186 | WP_001187243.1 | DUF3113 family protein | - |
| P3U31_RS07190 (P3U31_07190) | - | 1515630..1516034 (-) | 405 | WP_000049794.1 | DUF1064 domain-containing protein | - |
| P3U31_RS07195 (P3U31_07195) | - | 1516044..1516265 (-) | 222 | WP_015984512.1 | DUF3269 family protein | - |
| P3U31_RS07200 (P3U31_07200) | - | 1516278..1516436 (-) | 159 | WP_000256589.1 | hypothetical protein | - |
| P3U31_RS07205 (P3U31_07205) | - | 1516430..1517209 (-) | 780 | WP_000803062.1 | ATP-binding protein | - |
| P3U31_RS07210 (P3U31_07210) | - | 1517219..1517989 (-) | 771 | WP_000190253.1 | conserved phage C-terminal domain-containing protein | - |
| P3U31_RS07215 (P3U31_07215) | - | 1518055..1518336 (+) | 282 | WP_000414755.1 | hypothetical protein | - |
| P3U31_RS07220 (P3U31_07220) | - | 1518329..1518478 (-) | 150 | WP_001081076.1 | hypothetical protein | - |
| P3U31_RS07225 (P3U31_07225) | - | 1518475..1519149 (-) | 675 | WP_001124439.1 | putative HNHc nuclease | - |
| P3U31_RS07230 (P3U31_07230) | ssbA | 1519163..1519591 (-) | 429 | WP_000934385.1 | single-stranded DNA-binding protein | Machinery gene |
| P3U31_RS07235 (P3U31_07235) | - | 1519591..1520214 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| P3U31_RS07240 (P3U31_07240) | - | 1520207..1520428 (-) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| P3U31_RS07245 (P3U31_07245) | - | 1520438..1520698 (-) | 261 | WP_000291090.1 | DUF1108 family protein | - |
| P3U31_RS07250 (P3U31_07250) | - | 1520790..1520951 (-) | 162 | WP_103147754.1 | DUF1270 domain-containing protein | - |
| P3U31_RS07255 (P3U31_07255) | - | 1520963..1521226 (-) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| P3U31_RS07260 (P3U31_07260) | - | 1521375..1521474 (-) | 100 | Protein_1424 | hypothetical protein | - |
| P3U31_RS07265 (P3U31_07265) | - | 1521471..1521797 (-) | 327 | WP_001025595.1 | hypothetical protein | - |
| P3U31_RS07270 (P3U31_07270) | - | 1521853..1522080 (+) | 228 | WP_000801108.1 | hypothetical protein | - |
| P3U31_RS07275 (P3U31_07275) | - | 1522082..1522273 (-) | 192 | WP_000502678.1 | hypothetical protein | - |
| P3U31_RS07280 (P3U31_07280) | - | 1522330..1522539 (+) | 210 | WP_000772137.1 | hypothetical protein | - |
| P3U31_RS07285 (P3U31_07285) | - | 1522532..1522672 (-) | 141 | WP_000939495.1 | hypothetical protein | - |
| P3U31_RS07290 (P3U31_07290) | - | 1522687..1523130 (-) | 444 | WP_015997085.1 | hypothetical protein | - |
| P3U31_RS07295 (P3U31_07295) | - | 1523144..1523923 (-) | 780 | WP_021187711.1 | phage antirepressor | - |
| P3U31_RS07300 (P3U31_07300) | - | 1523938..1524156 (-) | 219 | WP_001198673.1 | helix-turn-helix transcriptional regulator | - |
| P3U31_RS07305 (P3U31_07305) | - | 1524298..1525017 (+) | 720 | WP_320419579.1 | XRE family transcriptional regulator | - |
| P3U31_RS07310 (P3U31_07310) | - | 1525029..1525184 (+) | 156 | WP_001049399.1 | hypothetical protein | - |
| P3U31_RS07315 (P3U31_07315) | - | 1525171..1525356 (+) | 186 | WP_001089804.1 | hypothetical protein | - |
| P3U31_RS07320 (P3U31_07320) | - | 1525556..1525702 (+) | 147 | WP_001795334.1 | hypothetical protein | - |
| P3U31_RS07325 (P3U31_07325) | - | 1525699..1526313 (-) | 615 | WP_000191464.1 | hypothetical protein | - |
| P3U31_RS07330 (P3U31_07330) | - | 1526439..1527644 (+) | 1206 | WP_031864865.1 | tyrosine-type recombinase/integrase | - |
| P3U31_RS07335 (P3U31_07335) | - | 1527687..1529714 (-) | 2028 | WP_001793477.1 | hypothetical protein | - |
| P3U31_RS07340 (P3U31_07340) | - | 1529726..1530634 (-) | 909 | WP_001641538.1 | DUF1672 domain-containing protein | - |
| P3U31_RS07345 (P3U31_07345) | srrB | 1530879..1532630 (-) | 1752 | WP_052995496.1 | two-component system sensor histidine kinase SrrB | - |
| P3U31_RS07350 (P3U31_07350) | srrA | 1532611..1533336 (-) | 726 | WP_000064078.1 | two-component system response regulator SrrA | - |
| P3U31_RS07355 (P3U31_07355) | - | 1533469..1534206 (-) | 738 | WP_000159577.1 | pseudouridine synthase | - |
| P3U31_RS07360 (P3U31_07360) | scpB | 1534199..1534741 (-) | 543 | WP_000368654.1 | SMC-Scp complex subunit ScpB | - |
| P3U31_RS07365 (P3U31_07365) | - | 1534734..1535465 (-) | 732 | WP_000273371.1 | segregation and condensation protein A | - |
| P3U31_RS07370 (P3U31_07370) | - | 1535557..1536063 (+) | 507 | WP_001183429.1 | DUF309 domain-containing protein | - |
| P3U31_RS07375 (P3U31_07375) | xerD | 1536141..1537028 (-) | 888 | WP_000447733.1 | site-specific tyrosine recombinase XerD | - |
| P3U31_RS07380 (P3U31_07380) | - | 1537077..1537526 (-) | 450 | WP_000392691.1 | Fur family transcriptional regulator | - |
| P3U31_RS07385 (P3U31_07385) | - | 1537631..1538173 (-) | 543 | WP_000365246.1 | NUDIX hydrolase | - |
| P3U31_RS07390 (P3U31_07390) | - | 1538255..1539163 (+) | 909 | WP_320419580.1 | aldo/keto reductase | - |
| P3U31_RS07395 (P3U31_07395) | - | 1539379..1539627 (-) | 249 | WP_000995804.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15872.58 Da Isoelectric Point: 8.4825
>NTDB_id=802031 P3U31_RS07230 WP_000934385.1 1519163..1519591(-) (ssbA) [Staphylococcus aureus strain Dog138]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=802031 P3U31_RS07230 WP_000934385.1 1519163..1519591(-) (ssbA) [Staphylococcus aureus strain Dog138]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |