Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | P3U47_RS04100 | Genome accession | NZ_CP120001 |
| Coordinates | 843670..844095 (+) | Length | 141 a.a. |
| NCBI ID | WP_000934780.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain Dog165 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 834629..884952 | 843670..844095 | within | 0 |
Gene organization within MGE regions
Location: 834629..884952
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3U47_RS04010 (P3U47_04010) | sufB | 834629..836026 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| P3U47_RS04015 (P3U47_04015) | - | 836094..837143 (-) | 1050 | WP_001145730.1 | tyrosine-type recombinase/integrase | - |
| P3U47_RS04020 (P3U47_04020) | - | 837340..838044 (-) | 705 | WP_017804779.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| P3U47_RS04025 (P3U47_04025) | - | 838080..838265 (-) | 186 | WP_070005151.1 | hypothetical protein | - |
| P3U47_RS04030 (P3U47_04030) | - | 838315..838449 (-) | 135 | WP_255777535.1 | hypothetical protein | - |
| P3U47_RS04035 (P3U47_04035) | - | 838461..839168 (-) | 708 | WP_029549355.1 | helix-turn-helix domain-containing protein | - |
| P3U47_RS04040 (P3U47_04040) | - | 839339..839578 (+) | 240 | WP_070005150.1 | helix-turn-helix transcriptional regulator | - |
| P3U47_RS04045 (P3U47_04045) | - | 839715..839897 (-) | 183 | WP_029549357.1 | hypothetical protein | - |
| P3U47_RS04050 (P3U47_04050) | - | 840337..840522 (+) | 186 | WP_000933365.1 | helix-turn-helix domain-containing protein | - |
| P3U47_RS04055 (P3U47_04055) | - | 840524..841273 (+) | 750 | WP_031883511.1 | phage antirepressor KilAC domain-containing protein | - |
| P3U47_RS04060 (P3U47_04060) | - | 841289..841492 (+) | 204 | Protein_787 | hypothetical protein | - |
| P3U47_RS04065 (P3U47_04065) | - | 841460..841705 (-) | 246 | WP_000122246.1 | hypothetical protein | - |
| P3U47_RS04070 (P3U47_04070) | - | 841776..841997 (+) | 222 | WP_000594790.1 | hypothetical protein | - |
| P3U47_RS04075 (P3U47_04075) | - | 841990..842151 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| P3U47_RS04080 (P3U47_04080) | - | 842241..842558 (+) | 318 | WP_000829610.1 | hypothetical protein | - |
| P3U47_RS04085 (P3U47_04085) | - | 842563..842823 (+) | 261 | WP_001556704.1 | DUF1108 family protein | - |
| P3U47_RS04090 (P3U47_04090) | - | 842833..843054 (+) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| P3U47_RS04095 (P3U47_04095) | - | 843047..843670 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| P3U47_RS04100 (P3U47_04100) | ssbA | 843670..844095 (+) | 426 | WP_000934780.1 | single-stranded DNA-binding protein | Machinery gene |
| P3U47_RS04105 (P3U47_04105) | - | 844109..844783 (+) | 675 | WP_031874427.1 | putative HNHc nuclease | - |
| P3U47_RS04110 (P3U47_04110) | - | 844889..845746 (-) | 858 | WP_000371250.1 | DUF4393 domain-containing protein | - |
| P3U47_RS04115 (P3U47_04115) | - | 845811..846581 (+) | 771 | WP_031784292.1 | conserved phage C-terminal domain-containing protein | - |
| P3U47_RS04120 (P3U47_04120) | - | 846591..847370 (+) | 780 | WP_000803062.1 | ATP-binding protein | - |
| P3U47_RS04125 (P3U47_04125) | - | 847364..847522 (+) | 159 | WP_000256596.1 | hypothetical protein | - |
| P3U47_RS04130 (P3U47_04130) | - | 847535..847756 (+) | 222 | WP_072422790.1 | DUF3269 family protein | - |
| P3U47_RS04135 (P3U47_04135) | - | 847767..848171 (+) | 405 | WP_015997090.1 | DUF1064 domain-containing protein | - |
| P3U47_RS04140 (P3U47_04140) | - | 848176..848361 (+) | 186 | WP_001187233.1 | DUF3113 family protein | - |
| P3U47_RS04145 (P3U47_04145) | - | 848362..848718 (+) | 357 | WP_000029388.1 | SA1788 family PVL leukocidin-associated protein | - |
| P3U47_RS04150 (P3U47_04150) | - | 848722..848964 (+) | 243 | WP_072414288.1 | phi PVL orf 51-like protein | - |
| P3U47_RS04155 (P3U47_04155) | - | 848978..849409 (+) | 432 | WP_072414287.1 | hypothetical protein | - |
| P3U47_RS04160 (P3U47_04160) | - | 849406..849690 (+) | 285 | WP_072414286.1 | hypothetical protein | - |
| P3U47_RS04165 (P3U47_04165) | - | 849683..849937 (+) | 255 | WP_031875643.1 | DUF1024 family protein | - |
| P3U47_RS04170 (P3U47_04170) | - | 849924..850094 (+) | 171 | WP_031927913.1 | hypothetical protein | - |
| P3U47_RS04175 (P3U47_04175) | - | 850087..850617 (+) | 531 | WP_000185662.1 | dUTPase | - |
| P3U47_RS04180 (P3U47_04180) | - | 850654..850842 (+) | 189 | WP_000195782.1 | DUF1381 domain-containing protein | - |
| P3U47_RS04185 (P3U47_04185) | - | 850817..851017 (+) | 201 | WP_001125016.1 | hypothetical protein | - |
| P3U47_RS04190 (P3U47_04190) | rinB | 851020..851193 (+) | 174 | WP_177244127.1 | transcriptional activator RinB | - |
| P3U47_RS04195 (P3U47_04195) | - | 851194..851340 (+) | 147 | WP_000990005.1 | hypothetical protein | - |
| P3U47_RS04200 (P3U47_04200) | - | 851364..851786 (+) | 423 | WP_000162699.1 | RinA family phage transcriptional activator | - |
| P3U47_RS04205 (P3U47_04205) | - | 851974..852414 (+) | 441 | WP_001003271.1 | terminase small subunit | - |
| P3U47_RS04210 (P3U47_04210) | - | 852401..853678 (+) | 1278 | WP_016047536.1 | PBSX family phage terminase large subunit | - |
| P3U47_RS04215 (P3U47_04215) | - | 853689..855224 (+) | 1536 | WP_000921890.1 | phage portal protein | - |
| P3U47_RS04220 (P3U47_04220) | - | 855231..856226 (+) | 996 | WP_001133043.1 | minor capsid protein | - |
| P3U47_RS04225 (P3U47_04225) | - | 856299..856469 (+) | 171 | WP_000072208.1 | hypothetical protein | - |
| P3U47_RS04230 (P3U47_04230) | - | 856497..856584 (+) | 88 | Protein_821 | hypothetical protein | - |
| P3U47_RS04235 (P3U47_04235) | - | 856578..857198 (+) | 621 | WP_000392151.1 | DUF4355 domain-containing protein | - |
| P3U47_RS04240 (P3U47_04240) | - | 857212..858186 (+) | 975 | WP_000438511.1 | phage major capsid protein | - |
| P3U47_RS04245 (P3U47_04245) | - | 858208..858495 (+) | 288 | WP_001114086.1 | hypothetical protein | - |
| P3U47_RS04250 (P3U47_04250) | - | 858504..858836 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| P3U47_RS04255 (P3U47_04255) | - | 858833..859135 (+) | 303 | WP_025175363.1 | hypothetical protein | - |
| P3U47_RS04260 (P3U47_04260) | - | 859135..859482 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| P3U47_RS04265 (P3U47_04265) | - | 859494..859877 (+) | 384 | WP_000188649.1 | hypothetical protein | - |
| P3U47_RS04270 (P3U47_04270) | - | 859896..860477 (+) | 582 | WP_000002577.1 | phage major tail protein, TP901-1 family | - |
| P3U47_RS04275 (P3U47_04275) | - | 860539..860904 (+) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| P3U47_RS04280 (P3U47_04280) | - | 860934..861278 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| P3U47_RS04285 (P3U47_04285) | - | 861295..864759 (+) | 3465 | WP_072414282.1 | hypothetical protein | - |
| P3U47_RS04290 (P3U47_04290) | - | 864772..865719 (+) | 948 | WP_138089175.1 | phage tail family protein | - |
| P3U47_RS04295 (P3U47_04295) | - | 865728..867629 (+) | 1902 | WP_072414280.1 | SGNH/GDSL hydrolase family protein | - |
| P3U47_RS04300 (P3U47_04300) | - | 867644..869554 (+) | 1911 | WP_072414279.1 | hypothetical protein | - |
| P3U47_RS04305 (P3U47_04305) | - | 869554..871377 (+) | 1824 | WP_103213551.1 | phage baseplate upper protein | - |
| P3U47_RS04310 (P3U47_04310) | - | 871377..871754 (+) | 378 | WP_103213552.1 | DUF2977 domain-containing protein | - |
| P3U47_RS04315 (P3U47_04315) | - | 871758..871931 (+) | 174 | WP_033858151.1 | XkdX family protein | - |
| P3U47_RS04320 (P3U47_04320) | - | 871971..872270 (+) | 300 | WP_000466777.1 | DUF2951 domain-containing protein | - |
| P3U47_RS04325 (P3U47_04325) | - | 872407..874305 (+) | 1899 | WP_138089176.1 | glucosaminidase domain-containing protein | - |
| P3U47_RS04330 (P3U47_04330) | - | 874318..875490 (+) | 1173 | WP_072422808.1 | BppU family phage baseplate upper protein | - |
| P3U47_RS04335 (P3U47_04335) | - | 875496..875891 (+) | 396 | WP_000398862.1 | hypothetical protein | - |
| P3U47_RS04340 (P3U47_04340) | - | 875947..876249 (+) | 303 | WP_000339144.1 | phage holin | - |
| P3U47_RS04345 (P3U47_04345) | - | 876260..877714 (+) | 1455 | WP_031835130.1 | N-acetylmuramoyl-L-alanine amidase | - |
| P3U47_RS04350 (P3U47_04350) | - | 877943..878662 (+) | 720 | WP_031835131.1 | trypsin-like serine peptidase | - |
| P3U47_RS04355 (P3U47_04355) | - | 878817..878969 (+) | 153 | WP_001788502.1 | hypothetical protein | - |
| P3U47_RS04360 (P3U47_04360) | - | 879040..879150 (+) | 111 | WP_000139425.1 | hypothetical protein | - |
| P3U47_RS04365 (P3U47_04365) | - | 879152..879337 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
| P3U47_RS04370 (P3U47_04370) | - | 880022..880159 (+) | 138 | WP_001790198.1 | chorismate mutase | - |
| P3U47_RS04375 (P3U47_04375) | - | 880165..880479 (-) | 315 | WP_000274029.1 | hypothetical protein | - |
| P3U47_RS04380 (P3U47_04380) | - | 880844..881884 (+) | 1041 | WP_000582326.1 | hemolysin family protein | - |
| P3U47_RS04385 (P3U47_04385) | - | 881898..882965 (+) | 1068 | WP_000267249.1 | NAD(P)H-dependent flavin oxidoreductase | - |
| P3U47_RS04390 (P3U47_04390) | - | 883032..883130 (+) | 99 | WP_031835132.1 | hypothetical protein | - |
| P3U47_RS04395 (P3U47_04395) | - | 883264..884112 (+) | 849 | WP_000608129.1 | DUF72 domain-containing protein | - |
| P3U47_RS04400 (P3U47_04400) | - | 884125..884952 (+) | 828 | WP_000927632.1 | sulfite exporter TauE/SafE family protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15847.32 Da Isoelectric Point: 4.6952
>NTDB_id=801455 P3U47_RS04100 WP_000934780.1 843670..844095(+) (ssbA) [Staphylococcus aureus strain Dog165]
MLNRTVLVGRLTKDPEYRTAPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNSNQQQNDNYQQQGQAQTGNNPFDNTEEDFSDLPF
MLNRTVLVGRLTKDPEYRTAPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNSNQQQNDNYQQQGQAQTGNNPFDNTEEDFSDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=801455 P3U47_RS04100 WP_000934780.1 843670..844095(+) (ssbA) [Staphylococcus aureus strain Dog165]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAGCGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGCAACCAACAACAAAATGACAATTATCAACAACAAGGACAAGCTCAAACTGGTAATAATCCGTTTGACAATACTGAAG
AAGATTTTTCAGACCTCCCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAGCGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGCAACCAACAACAAAATGACAATTATCAACAACAAGGACAAGCTCAAACTGGTAATAATCCGTTTGACAATACTGAAG
AAGATTTTTCAGACCTCCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
80.374 |
75.887 |
0.61 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.632 |
100 |
0.567 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
75.177 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.068 |
83.688 |
0.369 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
45.217 |
81.56 |
0.369 |
| ssbA | Streptococcus mutans UA159 |
44.348 |
81.56 |
0.362 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.22 |
83.688 |
0.362 |