Detailed information NTG0800743

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: P3K41_RS07470
• Genome accession: NZ_CP119713
• Coordinates: 1576661..1576972 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain CUVET17-948
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1571661..1581972

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P3K41_RS07430 (P3K41_07415)	gcvT	1572197..1573288 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
P3K41_RS07435 (P3K41_07420)	-	1573447..1573971 (-)	525	WP_001015120.1	shikimate kinase	-
P3K41_RS07440 (P3K41_07425)	-	1573961..1574107 (-)	147	WP_001789879.1	hypothetical protein	-
P3K41_RS07445	-	1574204..1574281 (-)	78	Protein_1463	type IV pilus minor pilin ComGF family protein	-
P3K41_RS07450 (P3K41_07430)	-	1574380..1575552 (+)	1173	WP_000195429.1	IS256-like element IS256 family transposase	-
P3K41_RS07455 (P3K41_07435)	comGF	1575536..1576033 (-)	498	WP_404968819.1	competence type IV pilus minor pilin ComGF	Machinery gene
P3K41_RS07460 (P3K41_07440)	comGE	1575951..1576250 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
P3K41_RS07465 (P3K41_07445)	comGD	1576237..1576683 (-)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
P3K41_RS07470 (P3K41_07450)	comGC	1576661..1576972 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
P3K41_RS07475 (P3K41_07455)	comGB	1576986..1578056 (-)	1071	WP_000776425.1	competence type IV pilus assembly protein ComGB	Machinery gene
P3K41_RS07480 (P3K41_07460)	comGA	1578028..1579002 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
P3K41_RS07485 (P3K41_07465)	-	1579054..1579677 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
P3K41_RS07490 (P3K41_07470)	-	1579674..1580003 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
P3K41_RS07495 (P3K41_07475)	-	1580003..1580989 (-)	987	WP_000161315.1	ROK family glucokinase	-
P3K41_RS07500 (P3K41_07480)	-	1580986..1581189 (-)	204	WP_404968820.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=800743 P3K41_RS07470 WP_000472256.1 1576661..1576972(-) (comGC) [Staphylococcus aureus strain CUVET17-948]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=800743 P3K41_RS07470 WP_000472256.1 1576661..1576972(-) (comGC) [Staphylococcus aureus strain CUVET17-948]
ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369