Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | P3K38_RS10610 | Genome accession | NZ_CP119682 |
| Coordinates | 2166431..2166844 (-) | Length | 137 a.a. |
| NCBI ID | WP_404968945.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain CUVET18-1965 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2133605..2174261 | 2166431..2166844 | within | 0 |
Gene organization within MGE regions
Location: 2133605..2174261
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3K38_RS10365 (P3K38_10260) | - | 2134020..2134775 (-) | 756 | WP_037543567.1 | CHAP domain-containing protein | - |
| P3K38_RS10370 (P3K38_10265) | - | 2134788..2135042 (-) | 255 | WP_015728847.1 | phage holin | - |
| P3K38_RS10375 (P3K38_10270) | - | 2135060..2136949 (-) | 1890 | WP_404968934.1 | glucosaminidase domain-containing protein | - |
| P3K38_RS10380 (P3K38_10275) | - | 2137071..2137445 (-) | 375 | WP_015728845.1 | hypothetical protein | - |
| P3K38_RS10385 (P3K38_10280) | - | 2137438..2138748 (-) | 1311 | WP_404968935.1 | BppU family phage baseplate upper protein | - |
| P3K38_RS10390 (P3K38_10285) | - | 2138765..2139808 (-) | 1044 | WP_096533862.1 | SGNH/GDSL hydrolase family protein | - |
| P3K38_RS10395 (P3K38_10290) | - | 2139820..2140512 (-) | 693 | WP_096533863.1 | hypothetical protein | - |
| P3K38_RS10400 (P3K38_10295) | - | 2140516..2141913 (-) | 1398 | WP_096533864.1 | phage tail protein | - |
| P3K38_RS10405 (P3K38_10300) | - | 2141926..2142858 (-) | 933 | WP_096533865.1 | phage tail family protein | - |
| P3K38_RS10410 (P3K38_10305) | - | 2142871..2145990 (-) | 3120 | WP_110144983.1 | phage tail protein | - |
| P3K38_RS10415 (P3K38_10310) | - | 2146007..2146357 (-) | 351 | WP_096533867.1 | hypothetical protein | - |
| P3K38_RS10420 (P3K38_10315) | - | 2146387..2146767 (-) | 381 | WP_096533868.1 | tail assembly chaperone | - |
| P3K38_RS10425 (P3K38_10320) | - | 2146827..2147480 (-) | 654 | WP_096533869.1 | phage major tail protein, TP901-1 family | - |
| P3K38_RS10430 (P3K38_10325) | - | 2147498..2147893 (-) | 396 | WP_096533870.1 | hypothetical protein | - |
| P3K38_RS10435 (P3K38_10330) | - | 2147905..2148255 (-) | 351 | WP_096533871.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| P3K38_RS10440 (P3K38_10335) | - | 2148245..2148559 (-) | 315 | WP_060830212.1 | hypothetical protein | - |
| P3K38_RS10445 (P3K38_10340) | - | 2148556..2148888 (-) | 333 | WP_316635251.1 | phage head-tail connector protein | - |
| P3K38_RS10450 (P3K38_10345) | - | 2148900..2149349 (-) | 450 | WP_096533873.1 | Ig-like domain-containing protein | - |
| P3K38_RS10455 (P3K38_10350) | - | 2149439..2150350 (-) | 912 | WP_096533874.1 | capsid protein | - |
| P3K38_RS10460 (P3K38_10355) | - | 2150368..2150976 (-) | 609 | WP_404968936.1 | DUF4355 domain-containing protein | - |
| P3K38_RS10465 (P3K38_10360) | - | 2151128..2151322 (-) | 195 | WP_096533876.1 | LSM domain protein | - |
| P3K38_RS10470 (P3K38_10365) | - | 2151319..2152671 (-) | 1353 | WP_110144985.1 | minor capsid protein | - |
| P3K38_RS10475 (P3K38_10370) | - | 2152664..2154109 (-) | 1446 | WP_404959962.1 | phage portal protein | - |
| P3K38_RS10480 (P3K38_10375) | - | 2154121..2155392 (-) | 1272 | WP_404968937.1 | PBSX family phage terminase large subunit | - |
| P3K38_RS10485 (P3K38_10380) | - | 2155379..2155822 (-) | 444 | WP_096533879.1 | terminase small subunit | - |
| P3K38_RS10490 (P3K38_10385) | - | 2155892..2156119 (-) | 228 | WP_096533880.1 | hypothetical protein | - |
| P3K38_RS10495 (P3K38_10390) | - | 2156318..2156737 (-) | 420 | WP_065354588.1 | transcriptional regulator | - |
| P3K38_RS10500 (P3K38_10395) | - | 2156740..2156892 (-) | 153 | WP_179292371.1 | hypothetical protein | - |
| P3K38_RS10505 (P3K38_10400) | rinB | 2156892..2157062 (-) | 171 | WP_096533881.1 | transcriptional activator RinB | - |
| P3K38_RS10510 (P3K38_10405) | - | 2157078..2157266 (-) | 189 | WP_096533882.1 | DUF1381 domain-containing protein | - |
| P3K38_RS10515 (P3K38_10410) | - | 2157263..2157727 (-) | 465 | WP_065354067.1 | class I SAM-dependent methyltransferase | - |
| P3K38_RS10520 (P3K38_10415) | - | 2157791..2158327 (-) | 537 | WP_203162917.1 | dUTPase | - |
| P3K38_RS10525 (P3K38_10420) | - | 2158346..2158717 (-) | 372 | WP_096533174.1 | hypothetical protein | - |
| P3K38_RS10530 (P3K38_10425) | - | 2158719..2158985 (-) | 267 | WP_037543610.1 | hypothetical protein | - |
| P3K38_RS10535 (P3K38_10430) | - | 2159008..2159268 (-) | 261 | WP_037542743.1 | hypothetical protein | - |
| P3K38_RS10540 (P3K38_10435) | - | 2159269..2159484 (-) | 216 | WP_103866929.1 | hypothetical protein | - |
| P3K38_RS10545 (P3K38_10440) | - | 2159484..2159870 (-) | 387 | WP_234985437.1 | hypothetical protein | - |
| P3K38_RS10550 (P3K38_10445) | - | 2159870..2160046 (-) | 177 | WP_019169002.1 | hypothetical protein | - |
| P3K38_RS10555 (P3K38_10450) | - | 2160117..2161076 (-) | 960 | WP_096533889.1 | DNA cytosine methyltransferase | - |
| P3K38_RS10560 (P3K38_10455) | - | 2161073..2161498 (-) | 426 | WP_404968938.1 | DUF3310 domain-containing protein | - |
| P3K38_RS10565 (P3K38_10460) | - | 2161523..2161687 (-) | 165 | WP_404968939.1 | hypothetical protein | - |
| P3K38_RS10570 (P3K38_10465) | - | 2161684..2162004 (-) | 321 | WP_404968940.1 | hypothetical protein | - |
| P3K38_RS10575 (P3K38_10470) | - | 2162017..2162235 (-) | 219 | WP_096533165.1 | hypothetical protein | - |
| P3K38_RS10580 (P3K38_10475) | - | 2162219..2162659 (-) | 441 | WP_189695503.1 | RusA family crossover junction endodeoxyribonuclease | - |
| P3K38_RS10585 (P3K38_10480) | - | 2162861..2164105 (-) | 1245 | WP_404968941.1 | DnaB helicase C-terminal domain-containing protein | - |
| P3K38_RS10590 (P3K38_10485) | - | 2164098..2164445 (-) | 348 | WP_404968942.1 | hypothetical protein | - |
| P3K38_RS10595 (P3K38_10490) | - | 2164450..2165196 (-) | 747 | WP_404968943.1 | DnaD domain protein | - |
| P3K38_RS10600 (P3K38_10495) | - | 2165189..2165866 (-) | 678 | WP_404968944.1 | putative HNHc nuclease | - |
| P3K38_RS10605 (P3K38_10500) | - | 2165867..2166418 (-) | 552 | WP_099989996.1 | NUMOD4 motif-containing HNH endonuclease | - |
| P3K38_RS10610 (P3K38_10505) | ssbA | 2166431..2166844 (-) | 414 | WP_404968945.1 | single-stranded DNA-binding protein | Machinery gene |
| P3K38_RS10615 (P3K38_10510) | - | 2166844..2167512 (-) | 669 | WP_015728804.1 | ERF family protein | - |
| P3K38_RS10620 (P3K38_10515) | - | 2167513..2167998 (-) | 486 | WP_063282619.1 | siphovirus Gp157 family protein | - |
| P3K38_RS10625 (P3K38_10520) | - | 2167991..2168245 (-) | 255 | WP_063282618.1 | hypothetical protein | - |
| P3K38_RS10630 (P3K38_10525) | - | 2168257..2168517 (-) | 261 | WP_063282617.1 | DUF1108 family protein | - |
| P3K38_RS10635 (P3K38_10530) | - | 2168777..2169100 (-) | 324 | WP_100008589.1 | DUF771 domain-containing protein | - |
| P3K38_RS10640 (P3K38_10535) | - | 2169167..2169406 (+) | 240 | WP_103866961.1 | hypothetical protein | - |
| P3K38_RS10645 (P3K38_10540) | - | 2169396..2169575 (-) | 180 | WP_103866963.1 | hypothetical protein | - |
| P3K38_RS10650 (P3K38_10545) | - | 2169681..2169875 (-) | 195 | WP_103866965.1 | hypothetical protein | - |
| P3K38_RS10655 (P3K38_10550) | - | 2169932..2170195 (+) | 264 | WP_103866967.1 | CRISPR-associated endonuclease Cas2 | - |
| P3K38_RS10660 (P3K38_10555) | - | 2170199..2170360 (-) | 162 | WP_168434020.1 | hypothetical protein | - |
| P3K38_RS10665 (P3K38_10560) | - | 2170371..2171138 (-) | 768 | WP_103866969.1 | phage regulatory protein/antirepressor Ant | - |
| P3K38_RS10670 (P3K38_10565) | - | 2171194..2171361 (-) | 168 | WP_168434021.1 | hypothetical protein | - |
| P3K38_RS10675 (P3K38_10570) | - | 2171375..2171590 (-) | 216 | WP_065354506.1 | transcriptional regulator | - |
| P3K38_RS10680 (P3K38_10575) | - | 2171785..2172476 (+) | 692 | Protein_2075 | helix-turn-helix domain-containing protein | - |
| P3K38_RS10685 (P3K38_10580) | - | 2172532..2173167 (+) | 636 | WP_103866971.1 | hypothetical protein | - |
| P3K38_RS10690 (P3K38_10585) | - | 2173224..2174261 (+) | 1038 | WP_103866973.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 137 a.a. Molecular weight: 15584.18 Da Isoelectric Point: 6.3425
>NTDB_id=800338 P3K38_RS10610 WP_404968945.1 2166431..2166844(-) (ssbA) [Staphylococcus pseudintermedius strain CUVET18-1965]
MINRVVLVGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVVCDSVQFLEPKSNGQSNSQAKQQQRQDNPFDNSDFDDSSLPF
MINRVVLVGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVVCDSVQFLEPKSNGQSNSQAKQQQRQDNPFDNSDFDDSSLPF
Nucleotide
Download Length: 414 bp
>NTDB_id=800338 P3K38_RS10610 WP_404968945.1 2166431..2166844(-) (ssbA) [Staphylococcus pseudintermedius strain CUVET18-1965]
ATGATCAACAGAGTCGTATTGGTAGGTCGATTAACAAAAGACCCGGAATTCAGAACGACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTGGCGGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTTGCAGGTGTAGATGGCCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTTGTGTGCGATAGCGTGCAATTTTTAGAACCTAAATC
TAATGGTCAATCGAACAGTCAAGCTAAACAACAACAAAGGCAGGACAATCCGTTTGATAACAGTGACTTTGATGACTCGT
CACTCCCGTTTTGA
ATGATCAACAGAGTCGTATTGGTAGGTCGATTAACAAAAGACCCGGAATTCAGAACGACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTGGCGGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTTGCAGGTGTAGATGGCCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTTGTGTGCGATAGCGTGCAATTTTTAGAACCTAAATC
TAATGGTCAATCGAACAGTCAAGCTAAACAACAACAAAGGCAGGACAATCCGTTTGATAACAGTGACTTTGATGACTCGT
CACTCCCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
71.028 |
78.102 |
0.555 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
59.813 |
78.102 |
0.467 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
77.372 |
0.445 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40 |
100 |
0.409 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
40 |
100 |
0.409 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40 |
100 |
0.409 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.286 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.286 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.286 |
100 |
0.401 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.286 |
100 |
0.401 |
| ssbA | Streptococcus mutans UA159 |
37.956 |
100 |
0.38 |