Detailed information NTG0798490

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: MT340_RS06700
• Genome accession: NZ_CP119327
• Coordinates: 1331977..1332297 (+)
• Length: 106 a.a.
• NCBI ID: WP_243589277.1
• Uniprot ID: -
• Organism: Staphylococcus sp. NRL 16/872
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1326977..1337297

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MT340_RS06670 (MT340_006670)	-	1327762..1327965 (+)	204	WP_243589272.1	YqgQ family protein	-
MT340_RS06675 (MT340_006675)	-	1327962..1328948 (+)	987	WP_243589273.1	ROK family glucokinase	-
MT340_RS06680 (MT340_006680)	-	1328948..1329271 (+)	324	WP_103298547.1	MTH1187 family thiamine-binding protein	-
MT340_RS06685 (MT340_006685)	-	1329273..1329899 (+)	627	WP_243589274.1	MBL fold metallo-hydrolase	-
MT340_RS06690 (MT340_006690)	comGA	1329951..1330925 (+)	975	WP_243589275.1	competence type IV pilus ATPase ComGA	Machinery gene
MT340_RS06695 (MT340_006695)	comGB	1330897..1331961 (+)	1065	WP_243589276.1	competence type IV pilus assembly protein ComGB	Machinery gene
MT340_RS06700 (MT340_006700)	comGC	1331977..1332297 (+)	321	WP_243589277.1	competence type IV pilus major pilin ComGC	Machinery gene
MT340_RS06705 (MT340_006705)	comGD	1332278..1332724 (+)	447	WP_243589278.1	competence type IV pilus minor pilin ComGD	-
MT340_RS06710 (MT340_006710)	-	1332711..1333004 (+)	294	WP_243589279.1	hypothetical protein	-
MT340_RS06715 (MT340_006715)	-	1332991..1333419 (+)	429	WP_243603697.1	hypothetical protein	-
MT340_RS06720 (MT340_006720)	-	1333578..1334096 (+)	519	WP_243590248.1	shikimate kinase	-
MT340_RS06725 (MT340_006725)	gcvT	1334305..1335396 (+)	1092	WP_103299024.1	glycine cleavage system aminomethyltransferase GcvT	-
MT340_RS06730 (MT340_006730)	gcvPA	1335413..1336765 (+)	1353	WP_243589281.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 106 a.a.
• Molecular weight: 11590.70 Da
• Isoelectric Point: 9.5858

>NTDB_id=798490 MT340_RS06700 WP_243589277.1 1331977..1332297(+) (comGC) [Staphylococcus sp. NRL 16/872]
MKNYVKKLKSLKAFTLIEMLLVLLIISVLLILIIPNIAKQTAHIQSTGCDAQVKMVNSQIEAFTLKNNRAPSSIDELVKD
GYIKEGQKSCKSGETITINNGEAVAS

Nucleotide

• Length: 321 bp

>NTDB_id=798490 MT340_RS06700 WP_243589277.1 1331977..1332297(+) (comGC) [Staphylococcus sp. NRL 16/872]
ATGAAAAATTATGTAAAAAAATTAAAAAGTTTAAAAGCATTTACGCTTATCGAAATGTTGCTTGTTTTACTCATTATCAG
CGTGTTACTAATTTTAATCATTCCTAATATTGCTAAACAAACAGCGCATATTCAATCTACGGGTTGCGATGCACAAGTAA
AGATGGTAAATAGCCAAATTGAAGCCTTCACACTTAAAAATAATAGAGCACCTAGCAGTATTGATGAATTAGTTAAAGAT
GGTTACATCAAAGAAGGACAAAAATCTTGTAAATCAGGAGAAACTATTACTATTAATAATGGTGAAGCTGTTGCAAGTTA
A

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (12-33)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	81.188	95.283	0.774
comGC	Staphylococcus aureus N315	81.188	95.283	0.774
comGC/cglC	Streptococcus pneumoniae TIGR4	44.66	97.17	0.434
comGC/cglC	Streptococcus mitis SK321	49.425	82.075	0.406
comGC/cglC	Streptococcus mitis NCTC 12261	49.425	82.075	0.406
comYC	Streptococcus gordonii str. Challis substr. CH1	49.412	80.189	0.396
comGC/cglC	Streptococcus pneumoniae R6	48.276	82.075	0.396
comGC/cglC	Streptococcus pneumoniae Rx1	48.276	82.075	0.396
comGC/cglC	Streptococcus pneumoniae D39	48.276	82.075	0.396
comYC	Streptococcus mutans UA140	48.235	80.189	0.387
comYC	Streptococcus mutans UA159	48.235	80.189	0.387
comGC	Bacillus subtilis subsp. subtilis str. 168	42.857	85.849	0.368