Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PVS71_RS07900 | Genome accession | NZ_CP118436 |
| Coordinates | 1600672..1601118 (-) | Length | 148 a.a. |
| NCBI ID | WP_274803643.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain GLP06 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1565792..1611739 | 1600672..1601118 | within | 0 |
Gene organization within MGE regions
Location: 1565792..1611739
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVS71_RS07690 (PVS71_07690) | dnaX | 1565792..1567528 (-) | 1737 | WP_053906345.1 | DNA polymerase III subunit gamma/tau | - |
| PVS71_RS07700 (PVS71_07700) | tadA | 1567743..1568228 (-) | 486 | WP_005916020.1 | tRNA adenosine(34) deaminase TadA | - |
| PVS71_RS07705 (PVS71_07705) | - | 1568221..1568826 (-) | 606 | WP_002832340.1 | class I SAM-dependent methyltransferase | - |
| PVS71_RS07710 (PVS71_07710) | nrdH | 1569048..1569278 (+) | 231 | WP_002832341.1 | glutaredoxin-like protein NrdH | - |
| PVS71_RS07715 (PVS71_07715) | nrdE | 1569371..1571536 (+) | 2166 | WP_053906347.1 | class 1b ribonucleoside-diphosphate reductase subunit alpha | - |
| PVS71_RS07720 (PVS71_07720) | nrdF | 1571555..1572508 (+) | 954 | WP_002832344.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
| PVS71_RS07725 (PVS71_07725) | - | 1572958..1573374 (-) | 417 | WP_274803615.1 | protein-export chaperone SecB | - |
| PVS71_RS07730 (PVS71_07730) | - | 1573375..1573704 (-) | 330 | WP_274803616.1 | hypothetical protein | - |
| PVS71_RS07735 (PVS71_07735) | - | 1573728..1574288 (-) | 561 | WP_274803617.1 | hypothetical protein | - |
| PVS71_RS07740 (PVS71_07740) | - | 1574417..1575538 (-) | 1122 | WP_274803618.1 | peptidoglycan recognition family protein | - |
| PVS71_RS07745 (PVS71_07745) | - | 1575522..1575776 (-) | 255 | WP_159219753.1 | phage holin | - |
| PVS71_RS07750 (PVS71_07750) | - | 1576110..1576262 (-) | 153 | WP_274803619.1 | XkdX family protein | - |
| PVS71_RS07755 (PVS71_07755) | - | 1576259..1576618 (-) | 360 | WP_274803620.1 | hypothetical protein | - |
| PVS71_RS07760 (PVS71_07760) | - | 1576632..1577354 (-) | 723 | WP_274803621.1 | hypothetical protein | - |
| PVS71_RS07765 (PVS71_07765) | - | 1577370..1579211 (-) | 1842 | WP_274803622.1 | BppU family phage baseplate upper protein | - |
| PVS71_RS07770 (PVS71_07770) | - | 1579211..1579534 (-) | 324 | WP_152688873.1 | hypothetical protein | - |
| PVS71_RS07775 (PVS71_07775) | - | 1579537..1579788 (-) | 252 | WP_274803623.1 | hypothetical protein | - |
| PVS71_RS07780 (PVS71_07780) | - | 1579781..1580896 (-) | 1116 | WP_274803624.1 | prophage endopeptidase tail family protein | - |
| PVS71_RS07785 (PVS71_07785) | - | 1580909..1581733 (-) | 825 | WP_274803625.1 | phage tail domain-containing protein | - |
| PVS71_RS07790 (PVS71_07790) | - | 1581733..1587294 (-) | 5562 | WP_274803626.1 | tape measure protein | - |
| PVS71_RS07795 (PVS71_07795) | - | 1587328..1587948 (-) | 621 | WP_274803627.1 | Gp15 family bacteriophage protein | - |
| PVS71_RS07800 (PVS71_07800) | - | 1587958..1588350 (-) | 393 | WP_065124790.1 | hypothetical protein | - |
| PVS71_RS07805 (PVS71_07805) | - | 1588426..1588893 (-) | 468 | WP_274803628.1 | Ig-like domain-containing protein | - |
| PVS71_RS07810 (PVS71_07810) | - | 1588967..1589503 (-) | 537 | WP_274803629.1 | capsid protein | - |
| PVS71_RS07815 (PVS71_07815) | - | 1589516..1589911 (-) | 396 | WP_274803630.1 | minor capsid protein | - |
| PVS71_RS07820 (PVS71_07820) | - | 1589911..1590255 (-) | 345 | WP_274803631.1 | minor capsid protein | - |
| PVS71_RS07825 (PVS71_07825) | - | 1590255..1590605 (-) | 351 | WP_159208612.1 | putative minor capsid protein | - |
| PVS71_RS07830 (PVS71_07830) | - | 1590602..1591018 (-) | 417 | WP_274803632.1 | hypothetical protein | - |
| PVS71_RS07835 (PVS71_07835) | - | 1591092..1591961 (-) | 870 | WP_128472038.1 | capsid protein | - |
| PVS71_RS07840 (PVS71_07840) | - | 1591974..1592546 (-) | 573 | WP_274803633.1 | phage scaffolding protein | - |
| PVS71_RS07845 (PVS71_07845) | - | 1592645..1593778 (-) | 1134 | WP_274803634.1 | phage minor capsid protein | - |
| PVS71_RS07850 (PVS71_07850) | - | 1593775..1595304 (-) | 1530 | WP_274803635.1 | phage portal protein | - |
| PVS71_RS07855 (PVS71_07855) | - | 1595314..1596627 (-) | 1314 | WP_274803636.1 | PBSX family phage terminase large subunit | - |
| PVS71_RS07860 (PVS71_07860) | - | 1596611..1597300 (-) | 690 | WP_274803637.1 | terminase | - |
| PVS71_RS07865 (PVS71_07865) | - | 1597374..1597937 (-) | 564 | WP_274803638.1 | hypothetical protein | - |
| PVS71_RS07880 (PVS71_07880) | - | 1598765..1599199 (-) | 435 | WP_274803639.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| PVS71_RS07885 (PVS71_07885) | - | 1599462..1599695 (-) | 234 | WP_274803640.1 | hypothetical protein | - |
| PVS71_RS07890 (PVS71_07890) | - | 1599832..1600431 (-) | 600 | WP_274803641.1 | hypothetical protein | - |
| PVS71_RS07895 (PVS71_07895) | - | 1600436..1600660 (-) | 225 | WP_274803642.1 | hypothetical protein | - |
| PVS71_RS07900 (PVS71_07900) | ssb | 1600672..1601118 (-) | 447 | WP_274803643.1 | single-stranded DNA-binding protein | Machinery gene |
| PVS71_RS07905 (PVS71_07905) | - | 1601111..1601320 (-) | 210 | WP_274803644.1 | hypothetical protein | - |
| PVS71_RS07910 (PVS71_07910) | - | 1601313..1601675 (-) | 363 | WP_274803645.1 | hypothetical protein | - |
| PVS71_RS07915 (PVS71_07915) | - | 1601617..1602342 (-) | 726 | WP_274803646.1 | putative HNHc nuclease | - |
| PVS71_RS07920 (PVS71_07920) | - | 1602347..1603183 (-) | 837 | WP_274803647.1 | helix-turn-helix domain-containing protein | - |
| PVS71_RS07925 (PVS71_07925) | - | 1603176..1604012 (-) | 837 | WP_274803648.1 | ERF family protein | - |
| PVS71_RS07930 (PVS71_07930) | - | 1604015..1604908 (-) | 894 | WP_274803649.1 | DUF1351 domain-containing protein | - |
| PVS71_RS07935 (PVS71_07935) | - | 1605001..1605144 (-) | 144 | WP_274803650.1 | hypothetical protein | - |
| PVS71_RS07940 (PVS71_07940) | - | 1605155..1605427 (-) | 273 | WP_128472030.1 | hypothetical protein | - |
| PVS71_RS07945 (PVS71_07945) | - | 1605409..1605876 (-) | 468 | WP_128472029.1 | helix-turn-helix transcriptional regulator | - |
| PVS71_RS07950 (PVS71_07950) | - | 1605959..1606174 (-) | 216 | WP_128472028.1 | hypothetical protein | - |
| PVS71_RS07955 (PVS71_07955) | - | 1606209..1606430 (-) | 222 | WP_128472027.1 | helix-turn-helix transcriptional regulator | - |
| PVS71_RS07960 (PVS71_07960) | - | 1606597..1606971 (+) | 375 | WP_128472026.1 | helix-turn-helix transcriptional regulator | - |
| PVS71_RS07965 (PVS71_07965) | - | 1606983..1607387 (+) | 405 | WP_128472025.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PVS71_RS07970 (PVS71_07970) | - | 1607414..1608331 (+) | 918 | WP_159208654.1 | SHOCT domain-containing protein | - |
| PVS71_RS07975 (PVS71_07975) | - | 1608538..1609080 (+) | 543 | WP_274803651.1 | CvpA family protein | - |
| PVS71_RS07980 (PVS71_07980) | - | 1609166..1609396 (-) | 231 | WP_274803652.1 | 2-hydroxymuconic semialdehyde hydrolase | - |
| PVS71_RS07985 (PVS71_07985) | - | 1609410..1610183 (+) | 774 | WP_274803653.1 | hypothetical protein | - |
| PVS71_RS07990 (PVS71_07990) | - | 1610654..1611739 (+) | 1086 | WP_274803654.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16633.22 Da Isoelectric Point: 5.1660
>NTDB_id=792514 PVS71_RS07900 WP_274803643.1 1600672..1601118(-) (ssb) [Pediococcus acidilactici strain GLP06]
MINRTVLVGRLTKDPEIRYTQSGTAVANFTMAVNRQFTNANGEREADFIGCIIWRKAAENFCNYTHKGSLVGIDGRIQTS
SYEKEGQRVYSTQVVVDSFSLLEPKQQSQQRGQQSNASDALHDNFGQPTNNYSQNNNDFGIDDNDLPF
MINRTVLVGRLTKDPEIRYTQSGTAVANFTMAVNRQFTNANGEREADFIGCIIWRKAAENFCNYTHKGSLVGIDGRIQTS
SYEKEGQRVYSTQVVVDSFSLLEPKQQSQQRGQQSNASDALHDNFGQPTNNYSQNNNDFGIDDNDLPF
Nucleotide
Download Length: 447 bp
>NTDB_id=792514 PVS71_RS07900 WP_274803643.1 1600672..1601118(-) (ssb) [Pediococcus acidilactici strain GLP06]
ATGATTAATCGAACCGTATTAGTTGGCCGGCTCACCAAAGATCCAGAAATCCGTTATACCCAATCAGGGACGGCGGTGGC
CAACTTTACCATGGCTGTGAACCGGCAGTTTACCAACGCTAATGGCGAGCGAGAAGCGGACTTTATTGGTTGTATCATTT
GGCGAAAGGCGGCCGAAAACTTCTGTAATTACACGCATAAAGGATCATTGGTCGGGATTGACGGTCGGATTCAAACGAGT
TCGTACGAGAAGGAAGGTCAGCGTGTTTACTCAACCCAGGTGGTTGTAGATAGCTTCTCGTTGTTGGAACCGAAACAACA
GAGCCAACAACGTGGCCAGCAATCTAACGCTAGCGATGCTTTGCATGACAATTTCGGCCAACCTACTAACAATTACAGCC
AGAATAATAACGATTTCGGCATTGACGATAACGATTTGCCGTTTTAG
ATGATTAATCGAACCGTATTAGTTGGCCGGCTCACCAAAGATCCAGAAATCCGTTATACCCAATCAGGGACGGCGGTGGC
CAACTTTACCATGGCTGTGAACCGGCAGTTTACCAACGCTAATGGCGAGCGAGAAGCGGACTTTATTGGTTGTATCATTT
GGCGAAAGGCGGCCGAAAACTTCTGTAATTACACGCATAAAGGATCATTGGTCGGGATTGACGGTCGGATTCAAACGAGT
TCGTACGAGAAGGAAGGTCAGCGTGTTTACTCAACCCAGGTGGTTGTAGATAGCTTCTCGTTGTTGGAACCGAAACAACA
GAGCCAACAACGTGGCCAGCAATCTAACGCTAGCGATGCTTTGCATGACAATTTCGGCCAACCTACTAACAATTACAGCC
AGAATAATAACGATTTCGGCATTGACGATAACGATTTGCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.706 |
100 |
0.628 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
64.151 |
71.622 |
0.459 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.364 |
74.324 |
0.419 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
39.189 |
100 |
0.392 |
| ssb | Vibrio cholerae strain A1552 |
33.14 |
100 |
0.385 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
38.514 |
100 |
0.385 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
38.514 |
100 |
0.385 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
37.838 |
100 |
0.378 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
37.838 |
100 |
0.378 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
37.838 |
100 |
0.378 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.838 |
100 |
0.378 |