Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PVS71_RS05765 | Genome accession | NZ_CP118436 |
| Coordinates | 1203042..1203467 (-) | Length | 141 a.a. |
| NCBI ID | WP_128211868.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain GLP06 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1173790..1217904 | 1203042..1203467 | within | 0 |
Gene organization within MGE regions
Location: 1173790..1217904
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVS71_RS05560 (PVS71_05560) | - | 1173790..1174911 (-) | 1122 | WP_128211675.1 | peptidoglycan recognition family protein | - |
| PVS71_RS05565 (PVS71_05565) | - | 1174895..1175137 (-) | 243 | WP_128211673.1 | phage holin | - |
| PVS71_RS05570 (PVS71_05570) | - | 1175137..1175520 (-) | 384 | WP_229092876.1 | hypothetical protein | - |
| PVS71_RS05575 (PVS71_05575) | - | 1175617..1175895 (-) | 279 | WP_128211671.1 | hypothetical protein | - |
| PVS71_RS05580 (PVS71_05580) | - | 1175895..1176854 (-) | 960 | WP_128211669.1 | hypothetical protein | - |
| PVS71_RS05585 (PVS71_05585) | - | 1176847..1178580 (-) | 1734 | WP_159215561.1 | BppU family phage baseplate upper protein | - |
| PVS71_RS05590 (PVS71_05590) | - | 1178580..1178891 (-) | 312 | WP_128211665.1 | hypothetical protein | - |
| PVS71_RS05595 (PVS71_05595) | - | 1178892..1179212 (-) | 321 | WP_128211663.1 | hypothetical protein | - |
| PVS71_RS05600 (PVS71_05600) | - | 1179202..1180416 (-) | 1215 | WP_128211660.1 | phage tail protein | - |
| PVS71_RS05605 (PVS71_05605) | - | 1180346..1181179 (-) | 834 | WP_128211658.1 | phage tail domain-containing protein | - |
| PVS71_RS05610 (PVS71_05610) | - | 1181192..1186306 (-) | 5115 | WP_128211656.1 | tape measure protein | - |
| PVS71_RS05615 (PVS71_05615) | - | 1186310..1186480 (-) | 171 | WP_164873654.1 | hypothetical protein | - |
| PVS71_RS05620 (PVS71_05620) | - | 1186513..1186917 (-) | 405 | WP_128211654.1 | phage tail tube assembly chaperone | - |
| PVS71_RS05625 (PVS71_05625) | - | 1187054..1187656 (-) | 603 | WP_159215558.1 | phage tail protein | - |
| PVS71_RS05630 (PVS71_05630) | - | 1187669..1188043 (-) | 375 | WP_159215557.1 | DUF806 family protein | - |
| PVS71_RS05635 (PVS71_05635) | - | 1188046..1188459 (-) | 414 | WP_128211804.1 | HK97 gp10 family phage protein | - |
| PVS71_RS05640 (PVS71_05640) | - | 1188459..1188818 (-) | 360 | WP_128211806.1 | phage head closure protein | - |
| PVS71_RS05645 (PVS71_05645) | - | 1188796..1189119 (-) | 324 | WP_128211808.1 | head-tail connector protein | - |
| PVS71_RS05650 (PVS71_05650) | - | 1189135..1189605 (-) | 471 | WP_128211810.1 | Ig-like domain-containing protein | - |
| PVS71_RS05655 (PVS71_05655) | - | 1189688..1191022 (-) | 1335 | WP_274803591.1 | phage major capsid protein | - |
| PVS71_RS05660 (PVS71_05660) | - | 1191023..1191616 (-) | 594 | WP_230312667.1 | HK97 family phage prohead protease | - |
| PVS71_RS05665 (PVS71_05665) | - | 1191597..1192709 (-) | 1113 | WP_128211812.1 | phage portal protein | - |
| PVS71_RS05670 (PVS71_05670) | - | 1192910..1194784 (-) | 1875 | WP_159215555.1 | terminase TerL endonuclease subunit | - |
| PVS71_RS05675 (PVS71_05675) | - | 1194784..1195248 (-) | 465 | WP_128211816.1 | phage terminase small subunit P27 family | - |
| PVS71_RS05680 (PVS71_05680) | - | 1195447..1195746 (-) | 300 | WP_128212003.1 | hypothetical protein | - |
| PVS71_RS05685 (PVS71_05685) | - | 1195743..1196198 (-) | 456 | WP_128212001.1 | HNH endonuclease signature motif containing protein | - |
| PVS71_RS05690 (PVS71_05690) | - | 1196283..1196603 (-) | 321 | WP_159215554.1 | bacteriocin immunity protein | - |
| PVS71_RS05695 (PVS71_05695) | - | 1196825..1197259 (-) | 435 | WP_128211997.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| PVS71_RS05700 (PVS71_05700) | - | 1197596..1197859 (-) | 264 | WP_128211995.1 | hypothetical protein | - |
| PVS71_RS05705 (PVS71_05705) | - | 1197873..1198181 (-) | 309 | WP_200834124.1 | hypothetical protein | - |
| PVS71_RS05710 (PVS71_05710) | - | 1198185..1198550 (-) | 366 | WP_159215553.1 | hypothetical protein | - |
| PVS71_RS05715 (PVS71_05715) | - | 1198567..1198767 (-) | 201 | WP_128211852.1 | hypothetical protein | - |
| PVS71_RS05720 (PVS71_05720) | - | 1198767..1198907 (-) | 141 | WP_159215552.1 | hypothetical protein | - |
| PVS71_RS05725 (PVS71_05725) | - | 1198910..1199281 (-) | 372 | WP_128211854.1 | N-acetylmuramoyl-L-alanine amidase | - |
| PVS71_RS05730 (PVS71_05730) | - | 1199268..1199417 (-) | 150 | WP_164873659.1 | hypothetical protein | - |
| PVS71_RS05735 (PVS71_05735) | - | 1199414..1199815 (-) | 402 | WP_128211856.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PVS71_RS05740 (PVS71_05740) | - | 1199796..1200428 (-) | 633 | WP_128211858.1 | RNA polymerase subunit sigma-70 | - |
| PVS71_RS05745 (PVS71_05745) | - | 1200546..1201190 (-) | 645 | WP_229092964.1 | ATP-binding protein | - |
| PVS71_RS05750 (PVS71_05750) | - | 1201342..1202094 (-) | 753 | WP_128211862.1 | conserved phage C-terminal domain-containing protein | - |
| PVS71_RS05755 (PVS71_05755) | - | 1202133..1202363 (-) | 231 | WP_128211864.1 | hypothetical protein | - |
| PVS71_RS05760 (PVS71_05760) | - | 1202347..1203030 (-) | 684 | WP_128211866.1 | putative HNHc nuclease | - |
| PVS71_RS05765 (PVS71_05765) | ssb | 1203042..1203467 (-) | 426 | WP_128211868.1 | single-stranded DNA-binding protein | Machinery gene |
| PVS71_RS05770 (PVS71_05770) | - | 1203460..1204158 (-) | 699 | WP_128211870.1 | ERF family protein | - |
| PVS71_RS05775 (PVS71_05775) | - | 1204159..1204614 (-) | 456 | WP_128211872.1 | chromosome segregation protein SMC | - |
| PVS71_RS05780 (PVS71_05780) | - | 1204838..1205500 (+) | 663 | WP_159215551.1 | hypothetical protein | - |
| PVS71_RS05785 (PVS71_05785) | - | 1205610..1205864 (-) | 255 | WP_128211987.1 | hypothetical protein | - |
| PVS71_RS05790 (PVS71_05790) | - | 1205965..1206294 (-) | 330 | WP_128211985.1 | DUF771 domain-containing protein | - |
| PVS71_RS05795 (PVS71_05795) | - | 1206591..1207373 (-) | 783 | WP_128211989.1 | phage antirepressor | - |
| PVS71_RS05800 (PVS71_05800) | - | 1207479..1207673 (+) | 195 | WP_128211983.1 | hypothetical protein | - |
| PVS71_RS05805 (PVS71_05805) | - | 1207665..1207802 (-) | 138 | WP_159215550.1 | hypothetical protein | - |
| PVS71_RS05810 (PVS71_05810) | - | 1207816..1208034 (-) | 219 | WP_235016628.1 | helix-turn-helix transcriptional regulator | - |
| PVS71_RS05815 (PVS71_05815) | - | 1208093..1208401 (+) | 309 | WP_128211981.1 | hypothetical protein | - |
| PVS71_RS05820 (PVS71_05820) | - | 1208391..1208597 (-) | 207 | WP_159215549.1 | hypothetical protein | - |
| PVS71_RS05825 (PVS71_05825) | - | 1208854..1209195 (+) | 342 | WP_002831842.1 | helix-turn-helix transcriptional regulator | - |
| PVS71_RS05830 (PVS71_05830) | - | 1209204..1209611 (+) | 408 | WP_128212081.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PVS71_RS05835 (PVS71_05835) | - | 1209674..1210801 (+) | 1128 | WP_274803598.1 | hypothetical protein | - |
| PVS71_RS05840 (PVS71_05840) | - | 1210948..1211145 (+) | 198 | WP_053905909.1 | hypothetical protein | - |
| PVS71_RS05845 (PVS71_05845) | - | 1211369..1212484 (+) | 1116 | WP_274803600.1 | site-specific integrase | - |
| PVS71_RS05855 (PVS71_05855) | - | 1213100..1213837 (+) | 738 | WP_229092935.1 | hypothetical protein | - |
| PVS71_RS05860 (PVS71_05860) | - | 1213871..1214548 (+) | 678 | WP_229092936.1 | hypothetical protein | - |
| PVS71_RS05865 (PVS71_05865) | - | 1214781..1215164 (-) | 384 | WP_053906291.1 | YxeA family protein | - |
| PVS71_RS05870 (PVS71_05870) | - | 1215362..1215610 (-) | 249 | WP_002830441.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| PVS71_RS05875 (PVS71_05875) | - | 1215834..1216430 (+) | 597 | WP_002830442.1 | TMEM175 family protein | - |
| PVS71_RS05880 (PVS71_05880) | - | 1216579..1217904 (-) | 1326 | WP_128211878.1 | Na+/H+ antiporter NhaC family protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15657.41 Da Isoelectric Point: 7.9971
>NTDB_id=792504 PVS71_RS05765 WP_128211868.1 1203042..1203467(-) (ssb) [Pediococcus acidilactici strain GLP06]
MINRTVLIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTQKGSLVGIDGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDLFANGGQSIDISDDQLPF
MINRTVLIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTQKGSLVGIDGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDLFANGGQSIDISDDQLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=792504 PVS71_RS05765 WP_128211868.1 1203042..1203467(-) (ssb) [Pediococcus acidilactici strain GLP06]
ATGATTAATCGAACAGTCCTAATAGGACGCCTAACTAAAGATGTTGAACTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGCGAAGCGGATTTCATCAACTGTGTAATGT
GGCGTAAGGCAGCAGAAAACTTTGCCAAGTACACACAAAAAGGTTCGTTGGTAGGCATTGACGGTCGAATTCAAACCCGT
TCGTACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCGTTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAATGCACGGCAAGCATCAACGCCGGGAGATCTGTTCGCCAATGGTGGTCAATCAATCGACA
TTTCAGATGATCAGCTCCCCTTTTAG
ATGATTAATCGAACAGTCCTAATAGGACGCCTAACTAAAGATGTTGAACTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGCGAAGCGGATTTCATCAACTGTGTAATGT
GGCGTAAGGCAGCAGAAAACTTTGCCAAGTACACACAAAAAGGTTCGTTGGTAGGCATTGACGGTCGAATTCAAACCCGT
TCGTACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCGTTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAATGCACGGCAAGCATCAACGCCGGGAGATCTGTTCGCCAATGGTGGTCAATCAATCGACA
TTTCAGATGATCAGCTCCCCTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.824 |
100 |
0.709 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
62.037 |
76.596 |
0.475 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.662 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.958 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.958 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.254 |
100 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
39.007 |
100 |
0.39 |