Detailed information NTG0789816

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: PUW52_RS01085
• Genome accession: NZ_CP118078
• Coordinates: 194227..194544 (+)
• Length: 105 a.a.
• NCBI ID: WP_003028473.1
• Uniprot ID: A0A0P0N5S2
• Organism: Streptococcus anginosus strain VSI16
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 189227..199544

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PUW52_RS01055 (PUW52_01055)	-	189352..189882 (+)	531	WP_024053133.1	aromatic acid exporter family protein	-
PUW52_RS01060 (PUW52_01060)	-	189959..190318 (+)	360	WP_003070793.1	MerR family transcriptional regulator	-
PUW52_RS01065 (PUW52_01065)	glnA	190356..191702 (+)	1347	WP_024053132.1	type I glutamate--ammonia ligase	-
PUW52_RS01070 (PUW52_01070)	-	191890..192255 (+)	366	WP_024053131.1	DUF1033 family protein	-
PUW52_RS01075 (PUW52_01075)	comYA	192325..193266 (+)	942	WP_024053130.1	competence type IV pilus ATPase ComGA	Machinery gene
PUW52_RS01080 (PUW52_01080)	comYB	193208..194230 (+)	1023	WP_024053129.1	competence type IV pilus assembly protein ComGB	Machinery gene
PUW52_RS01085 (PUW52_01085)	comYC	194227..194544 (+)	318	WP_003028473.1	competence type IV pilus major pilin ComGC	Machinery gene
PUW52_RS01090 (PUW52_01090)	comYD	194534..194932 (+)	399	WP_022525973.1	competence type IV pilus minor pilin ComGD	Machinery gene
PUW52_RS01095 (PUW52_01095)	comGE/cglE	194904..195197 (+)	294	WP_024053127.1	competence type IV pilus minor pilin ComGE	Machinery gene
PUW52_RS01100 (PUW52_01100)	comGF/cglF	195181..195618 (+)	438	WP_024053126.1	competence type IV pilus minor pilin ComGF	Machinery gene
PUW52_RS01105 (PUW52_01105)	comGG	195599..195925 (+)	327	WP_022525970.1	competence type IV pilus minor pilin ComGG	-
PUW52_RS01110 (PUW52_01110)	comYH	195997..196950 (+)	954	WP_024053125.1	class I SAM-dependent methyltransferase	Machinery gene
PUW52_RS01115 (PUW52_01115)	-	196997..198196 (+)	1200	WP_024053124.1	acetate kinase	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11622.72 Da
• Isoelectric Point: 10.1006

>NTDB_id=789816 PUW52_RS01085 WP_003028473.1 194227..194544(+) (comYC) [Streptococcus anginosus strain VSI16]
MKKLKSLKVKGFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLVNEGT
ITDKQAASYKAYYAKHTKEARSVAD

Nucleotide

• Length: 318 bp

>NTDB_id=789816 PUW52_RS01085 WP_003028473.1 194227..194544(+) (comYC) [Streptococcus anginosus strain VSI16]
ATGAAAAAATTAAAAAGTTTGAAGGTTAAAGGTTTTACTTTAGTAGAAATGTTAGTCGTGCTTCTTATCATCAGTGTTTT
GATGCTCTTATTTGTACCGAATTTGACCAAGCAAAAAGAAGCTGTAACGGAAAAAGGAAATGCAGCGGTGGTAAAAGTTG
TGGAAAGCCAGGCAGAGCTGTTTGAGGTCAATCACACCAATGAAAAAGCGACACTCTCAAAATTAGTCAACGAAGGAACG
ATTACAGACAAGCAGGCAGCATCTTATAAGGCTTACTATGCGAAACATACAAAAGAAGCTCGTTCTGTTGCAGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A0P0N5S2

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	73.333	100	0.733
comYC	Streptococcus mutans UA159	66.667	100	0.667
comYC	Streptococcus mutans UA140	66.667	100	0.667
comGC/cglC	Streptococcus mitis NCTC 12261	68.627	97.143	0.667
comGC/cglC	Streptococcus mitis SK321	68.627	97.143	0.667
comGC/cglC	Streptococcus pneumoniae R6	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae D39	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	97.143	0.648
comYC	Streptococcus suis isolate S10	66.292	84.762	0.562
comGC	Lactococcus lactis subsp. cremoris KW2	54.808	99.048	0.543