Detailed information NTG0789577

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: PUW71_RS01120
• Genome accession: NZ_CP118053
• Coordinates: 204789..205106 (+)
• Length: 105 a.a.
• NCBI ID: WP_003028473.1
• Uniprot ID: A0A0P0N5S2
• Organism: Streptococcus anginosus strain VSI40
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 199789..210106

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PUW71_RS01090 (PUW71_01090)	-	199914..200444 (+)	531	WP_070241503.1	aromatic acid exporter family protein	-
PUW71_RS01095 (PUW71_01095)	-	200521..200880 (+)	360	WP_003070793.1	MerR family transcriptional regulator	-
PUW71_RS01100 (PUW71_01100)	glnA	200918..202264 (+)	1347	WP_024053132.1	type I glutamate--ammonia ligase	-
PUW71_RS01105 (PUW71_01105)	-	202452..202817 (+)	366	WP_024053131.1	DUF1033 family protein	-
PUW71_RS01110 (PUW71_01110)	comYA	202887..203828 (+)	942	WP_024053130.1	competence type IV pilus ATPase ComGA	Machinery gene
PUW71_RS01115 (PUW71_01115)	comYB	203770..204792 (+)	1023	WP_171021869.1	competence type IV pilus assembly protein ComGB	Machinery gene
PUW71_RS01120 (PUW71_01120)	comYC	204789..205106 (+)	318	WP_003028473.1	competence type IV pilus major pilin ComGC	Machinery gene
PUW71_RS01125 (PUW71_01125)	comYD	205096..205494 (+)	399	WP_022525973.1	competence type IV pilus minor pilin ComGD	Machinery gene
PUW71_RS01130 (PUW71_01130)	comGE/cglE	205466..205759 (+)	294	WP_195916332.1	competence type IV pilus minor pilin ComGE	Machinery gene
PUW71_RS01135 (PUW71_01135)	comGF/cglF	205743..206180 (+)	438	WP_195916333.1	competence type IV pilus minor pilin ComGF	Machinery gene
PUW71_RS01140 (PUW71_01140)	comGG	206161..206487 (+)	327	WP_264342122.1	competence type IV pilus minor pilin ComGG	-
PUW71_RS01145 (PUW71_01145)	comYH	206559..207512 (+)	954	WP_195916334.1	class I SAM-dependent methyltransferase	Machinery gene
PUW71_RS01150 (PUW71_01150)	-	207559..208758 (+)	1200	WP_049517013.1	acetate kinase	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11622.72 Da
• Isoelectric Point: 10.1006

>NTDB_id=789577 PUW71_RS01120 WP_003028473.1 204789..205106(+) (comYC) [Streptococcus anginosus strain VSI40]
MKKLKSLKVKGFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLVNEGT
ITDKQAASYKAYYAKHTKEARSVAD

Nucleotide

• Length: 318 bp

>NTDB_id=789577 PUW71_RS01120 WP_003028473.1 204789..205106(+) (comYC) [Streptococcus anginosus strain VSI40]
ATGAAAAAATTAAAAAGTTTGAAGGTTAAAGGTTTTACTTTAGTAGAAATGTTAGTCGTGCTTCTTATCATCAGTGTTTT
GATGCTCTTATTTGTACCGAATTTGACCAAGCAAAAAGAAGCTGTAACGGAAAAAGGAAATGCAGCGGTGGTAAAAGTTG
TGGAAAGCCAGGCAGAGCTGTTTGAGGTCAATCACACCAATGAAAAAGCGACACTCTCAAAATTAGTCAACGAAGGAACG
ATTACAGACAAGCAGGCAGCATCTTATAAGGCTTACTATGCGAAACATACAAAAGAAGCTCGTTCTGTTGCAGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A0P0N5S2

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	73.333	100	0.733
comYC	Streptococcus mutans UA159	66.667	100	0.667
comYC	Streptococcus mutans UA140	66.667	100	0.667
comGC/cglC	Streptococcus mitis NCTC 12261	68.627	97.143	0.667
comGC/cglC	Streptococcus mitis SK321	68.627	97.143	0.667
comGC/cglC	Streptococcus pneumoniae R6	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae D39	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	97.143	0.648
comYC	Streptococcus suis isolate S10	66.292	84.762	0.562
comGC	Lactococcus lactis subsp. cremoris KW2	54.808	99.048	0.543