Detailed information NTG0789416

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: PUW46_RS07360
• Genome accession: NZ_CP118044
• Coordinates: 1542190..1542501 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain VSI56
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1537190..1547501

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PUW46_RS07325 (PUW46_07325)	gcvPA	1537692..1539038 (-)	1347	WP_275000702.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
PUW46_RS07330 (PUW46_07330)	gcvT	1539058..1540149 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
PUW46_RS07335 (PUW46_07335)	-	1540308..1540832 (-)	525	WP_001015121.1	shikimate kinase	-
PUW46_RS07340 (PUW46_07340)	-	1540822..1540968 (-)	147	WP_001789879.1	hypothetical protein	-
PUW46_RS07345 (PUW46_07345)	comGF	1541065..1541562 (-)	498	WP_020978197.1	competence type IV pilus minor pilin ComGF	Machinery gene
PUW46_RS07350 (PUW46_07350)	comGE	1541480..1541779 (-)	300	WP_000844410.1	hypothetical protein	Machinery gene
PUW46_RS07355 (PUW46_07355)	comGD	1541766..1542212 (-)	447	WP_001788899.1	competence type IV pilus minor pilin ComGD	Machinery gene
PUW46_RS07360 (PUW46_07360)	comGC	1542190..1542501 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
PUW46_RS07365 (PUW46_07365)	comGB	1542515..1543585 (-)	1071	WP_000776401.1	competence type IV pilus assembly protein ComGB	Machinery gene
PUW46_RS07370 (PUW46_07370)	comGA	1543557..1544531 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
PUW46_RS07375 (PUW46_07375)	-	1544583..1545206 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
PUW46_RS07380 (PUW46_07380)	-	1545203..1545532 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
PUW46_RS07385 (PUW46_07385)	-	1545532..1546518 (-)	987	WP_000161314.1	ROK family glucokinase	-
PUW46_RS07390 (PUW46_07390)	-	1546515..1546718 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=789416 PUW46_RS07360 WP_000472256.1 1542190..1542501(-) (comGC) [Staphylococcus aureus strain VSI56]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=789416 PUW46_RS07360 WP_000472256.1 1542190..1542501(-) (comGC) [Staphylococcus aureus strain VSI56]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369