Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | PUW57_RS01190 | Genome accession | NZ_CP118043 |
| Coordinates | 199362..199757 (+) | Length | 131 a.a. |
| NCBI ID | WP_000282447.1 | Uniprot ID | A0AAV3JLT6 |
| Organism | Streptococcus agalactiae strain VSI63 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 192393..253511 | 199362..199757 | within | 0 |
Gene organization within MGE regions
Location: 192393..253511
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW57_RS01135 (PUW57_01135) | - | 193103..193309 (+) | 207 | WP_000798241.1 | helix-turn-helix transcriptional regulator | - |
| PUW57_RS01140 (PUW57_01140) | - | 193368..193505 (+) | 138 | WP_001865900.1 | hypothetical protein | - |
| PUW57_RS01145 (PUW57_01145) | - | 193546..194001 (+) | 456 | WP_000905673.1 | hypothetical protein | - |
| PUW57_RS01150 (PUW57_01150) | - | 194070..194735 (+) | 666 | WP_000008113.1 | type II CAAX endopeptidase family protein | - |
| PUW57_RS01155 (PUW57_01155) | proC | 194756..195526 (-) | 771 | WP_001865901.1 | pyrroline-5-carboxylate reductase | - |
| PUW57_RS01160 (PUW57_01160) | pepA | 195596..196663 (-) | 1068 | WP_001281323.1 | glutamyl aminopeptidase | - |
| PUW57_RS01165 (PUW57_01165) | - | 196848..197087 (-) | 240 | WP_000660180.1 | hypothetical protein | - |
| PUW57_RS01170 (PUW57_01170) | - | 197248..197532 (+) | 285 | WP_000791272.1 | DUF4651 domain-containing protein | - |
| PUW57_RS01175 (PUW57_01175) | - | 197529..197852 (+) | 324 | WP_000602781.1 | thioredoxin family protein | - |
| PUW57_RS01180 (PUW57_01180) | ytpR | 197885..198511 (+) | 627 | WP_000578328.1 | YtpR family tRNA-binding protein | - |
| PUW57_RS01185 (PUW57_01185) | - | 198565..199281 (-) | 717 | WP_000186185.1 | class I SAM-dependent methyltransferase | - |
| PUW57_RS01190 (PUW57_01190) | ssbA | 199362..199757 (+) | 396 | WP_000282447.1 | single-stranded DNA-binding protein | Machinery gene |
| PUW57_RS01195 (PUW57_01195) | - | 199881..200525 (+) | 645 | WP_000416612.1 | HAD family hydrolase | - |
| PUW57_RS01200 (PUW57_01200) | - | 200552..202297 (+) | 1746 | WP_000930334.1 | LytS/YhcK type 5TM receptor domain-containing protein | - |
| PUW57_RS01205 (PUW57_01205) | - | 202278..203018 (+) | 741 | WP_000697630.1 | LytTR family transcriptional regulator DNA-binding domain-containing protein | - |
| PUW57_RS01210 (PUW57_01210) | - | 203188..203643 (+) | 456 | WP_000683316.1 | CidA/LrgA family protein | - |
| PUW57_RS01215 (PUW57_01215) | lrgB | 203645..204373 (+) | 729 | WP_000421724.1 | antiholin-like protein LrgB | - |
| PUW57_RS01220 (PUW57_01220) | - | 204616..206244 (+) | 1629 | WP_274999080.1 | ABC transporter substrate-binding protein | - |
| PUW57_RS01225 (PUW57_01225) | - | 206357..207334 (+) | 978 | WP_000680645.1 | ABC transporter permease | - |
| PUW57_RS01230 (PUW57_01230) | - | 207331..208152 (+) | 822 | WP_000603397.1 | ABC transporter permease | - |
| PUW57_RS01235 (PUW57_01235) | - | 208164..208967 (+) | 804 | WP_000140984.1 | ABC transporter ATP-binding protein | - |
| PUW57_RS01240 (PUW57_01240) | - | 208951..209577 (+) | 627 | WP_000171309.1 | ABC transporter ATP-binding protein | - |
| PUW57_RS01245 (PUW57_01245) | treP | 209860..211890 (+) | 2031 | WP_000434616.1 | PTS system trehalose-specific EIIBC component | - |
| PUW57_RS01250 (PUW57_01250) | treC | 212112..213737 (+) | 1626 | WP_000151017.1 | alpha,alpha-phosphotrehalase | - |
| PUW57_RS01255 (PUW57_01255) | - | 213953..215989 (+) | 2037 | WP_000228183.1 | BglG family transcription antiterminator | - |
| PUW57_RS01260 (PUW57_01260) | - | 215992..216275 (+) | 284 | Protein_192 | PTS sugar transporter subunit IIB | - |
| PUW57_RS01265 (PUW57_01265) | - | 216288..217643 (+) | 1356 | WP_000677361.1 | PTS ascorbate transporter subunit IIC | - |
| PUW57_RS01270 (PUW57_01270) | - | 217646..218503 (+) | 858 | WP_000203489.1 | transketolase | - |
| PUW57_RS01275 (PUW57_01275) | - | 218500..219429 (+) | 930 | WP_001203821.1 | transketolase C-terminal domain-containing protein | - |
| PUW57_RS01280 (PUW57_01280) | - | 219538..220797 (+) | 1260 | WP_001203068.1 | ferric reductase-like transmembrane domain-containing protein | - |
| PUW57_RS01285 (PUW57_01285) | rpsO | 220885..221154 (+) | 270 | WP_001018249.1 | 30S ribosomal protein S15 | - |
| PUW57_RS01290 (PUW57_01290) | pnp | 221535..223664 (+) | 2130 | WP_000043850.1 | polyribonucleotide nucleotidyltransferase | - |
| PUW57_RS01295 (PUW57_01295) | - | 223666..224418 (+) | 753 | WP_000204782.1 | SseB family protein | - |
| PUW57_RS01300 (PUW57_01300) | cysE | 224427..225011 (+) | 585 | WP_000539954.1 | serine O-acetyltransferase | - |
| PUW57_RS01305 (PUW57_01305) | - | 225021..225203 (+) | 183 | WP_000656476.1 | lipoprotein | - |
| PUW57_RS01310 (PUW57_01310) | cysS | 225200..226543 (+) | 1344 | WP_000591131.1 | cysteine--tRNA ligase | - |
| PUW57_RS01315 (PUW57_01315) | - | 226536..226922 (+) | 387 | WP_000568029.1 | Mini-ribonuclease 3 | - |
| PUW57_RS01320 (PUW57_01320) | rlmB | 227025..227780 (+) | 756 | WP_000178026.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| PUW57_RS01325 (PUW57_01325) | - | 227777..228295 (+) | 519 | WP_000716636.1 | NYN domain-containing protein | - |
| PUW57_RS01330 (PUW57_01330) | - | 228388..229248 (+) | 861 | WP_000143135.1 | DegV family protein | - |
| PUW57_RS01335 (PUW57_01335) | - | 229785..229904 (+) | 120 | Protein_207 | helix-turn-helix domain-containing protein | - |
| PUW57_RS01340 (PUW57_01340) | rplM | 230129..230575 (+) | 447 | WP_001865567.1 | 50S ribosomal protein L13 | - |
| PUW57_RS01345 (PUW57_01345) | rpsI | 230596..230987 (+) | 392 | Protein_209 | 30S ribosomal protein S9 | - |
| PUW57_RS01350 (PUW57_01350) | - | 231093..232316 (-) | 1224 | WP_000156560.1 | site-specific integrase | - |
| PUW57_RS01355 (PUW57_01355) | - | 232371..232643 (-) | 273 | WP_001196075.1 | helix-turn-helix domain-containing protein | - |
| PUW57_RS01360 (PUW57_01360) | - | 232754..233086 (-) | 333 | WP_000371058.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| PUW57_RS01365 (PUW57_01365) | - | 233073..233378 (-) | 306 | WP_000162871.1 | hypothetical protein | - |
| PUW57_RS01370 (PUW57_01370) | - | 233435..234490 (-) | 1056 | WP_000728345.1 | phage tail tip lysozyme | - |
| PUW57_RS01375 (PUW57_01375) | - | 234499..234681 (-) | 183 | WP_001882897.1 | hypothetical protein | - |
| PUW57_RS01380 (PUW57_01380) | - | 234722..236653 (-) | 1932 | WP_001154548.1 | hypothetical protein | - |
| PUW57_RS01385 (PUW57_01385) | - | 236666..239188 (-) | 2523 | WP_000243267.1 | ATP-binding protein | - |
| PUW57_RS01390 (PUW57_01390) | - | 239199..239615 (-) | 417 | WP_000410250.1 | conjugal transfer protein | - |
| PUW57_RS01395 (PUW57_01395) | - | 239617..239844 (-) | 228 | WP_000099227.1 | hypothetical protein | - |
| PUW57_RS01400 (PUW57_01400) | - | 239861..240853 (-) | 993 | WP_001098866.1 | conjugal transfer protein | - |
| PUW57_RS01405 (PUW57_01405) | - | 240863..241417 (-) | 555 | WP_000780011.1 | hypothetical protein | - |
| PUW57_RS01410 (PUW57_01410) | - | 241414..241650 (-) | 237 | WP_000456039.1 | hypothetical protein | - |
| PUW57_RS01415 (PUW57_01415) | - | 241670..242056 (-) | 387 | WP_000058816.1 | hypothetical protein | - |
| PUW57_RS01420 (PUW57_01420) | - | 242034..243266 (-) | 1233 | WP_000625216.1 | replication initiation factor domain-containing protein | - |
| PUW57_RS01425 (PUW57_01425) | - | 243478..245136 (-) | 1659 | WP_001882899.1 | FtsK/SpoIIIE domain-containing protein | - |
| PUW57_RS01430 (PUW57_01430) | - | 245143..245553 (-) | 411 | WP_000216328.1 | DUF961 family protein | - |
| PUW57_RS01435 (PUW57_01435) | - | 245576..245890 (-) | 315 | WP_000406626.1 | hypothetical protein | - |
| PUW57_RS01440 (PUW57_01440) | - | 246004..246231 (-) | 228 | WP_001105756.1 | hypothetical protein | - |
| PUW57_RS01445 (PUW57_01445) | - | 246228..246464 (-) | 237 | WP_001000876.1 | hypothetical protein | - |
| PUW57_RS01450 (PUW57_01450) | - | 246593..246871 (-) | 279 | WP_000285204.1 | type II toxin-antitoxin system YafQ family toxin | - |
| PUW57_RS01455 (PUW57_01455) | - | 246872..247144 (-) | 273 | WP_000246822.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| PUW57_RS01460 (PUW57_01460) | - | 247825..248187 (+) | 363 | WP_000483806.1 | helix-turn-helix domain-containing protein | - |
| PUW57_RS01465 (PUW57_01465) | - | 248194..249045 (+) | 852 | WP_001189027.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PUW57_RS01470 (PUW57_01470) | - | 249065..249427 (-) | 363 | WP_000722890.1 | hypothetical protein | - |
| PUW57_RS01475 (PUW57_01475) | - | 249515..251065 (-) | 1551 | WP_001145976.1 | DNA cytosine methyltransferase | - |
| PUW57_RS01480 (PUW57_01480) | - | 251259..251720 (+) | 462 | WP_000443123.1 | helix-turn-helix transcriptional regulator | - |
| PUW57_RS01485 (PUW57_01485) | - | 251720..252940 (+) | 1221 | WP_001159665.1 | MvaI/BcnI family restriction endonuclease | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14774.80 Da Isoelectric Point: 7.0189
>NTDB_id=789357 PUW57_RS01190 WP_000282447.1 199362..199757(+) (ssbA) [Streptococcus agalactiae strain VSI63]
MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETLASYGTKGSLISIDGELRTR
KYEKDGQTHYITEVLASSFQLLESRAQRAMRENNVSGDLSDLVLEEEELPF
MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETLASYGTKGSLISIDGELRTR
KYEKDGQTHYITEVLASSFQLLESRAQRAMRENNVSGDLSDLVLEEEELPF
Nucleotide
Download Length: 396 bp
>NTDB_id=789357 PUW57_RS01190 WP_000282447.1 199362..199757(+) (ssbA) [Streptococcus agalactiae strain VSI63]
ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTGAC
GCGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT
GGGGTCGTCTAGCGGAAACCCTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAATAGATGGTGAATTGCGTACGCGC
AAGTACGAAAAGGATGGTCAAACGCACTATATCACTGAAGTATTAGCATCATCATTTCAGTTGCTAGAAAGCCGTGCCCA
ACGTGCTATGCGTGAAAATAACGTTTCTGGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA
ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTGAC
GCGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT
GGGGTCGTCTAGCGGAAACCCTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAATAGATGGTGAATTGCGTACGCGC
AAGTACGAAAAGGATGGTCAAACGCACTATATCACTGAAGTATTAGCATCATCATTTCAGTTGCTAGAAAGCCGTGCCCA
ACGTGCTATGCGTGAAAATAACGTTTCTGGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Streptococcus mutans UA159 |
80.916 |
100 |
0.809 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
77.099 |
100 |
0.771 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
77.099 |
100 |
0.771 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
76.336 |
100 |
0.763 |
| ssbB/cilA | Streptococcus mitis SK321 |
76.336 |
100 |
0.763 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
60.526 |
87.023 |
0.527 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.943 |
80.916 |
0.412 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
46.018 |
86.26 |
0.397 |