Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PSQ91_RS04205 | Genome accession | NZ_CP117486 |
| Coordinates | 872960..873406 (+) | Length | 148 a.a. |
| NCBI ID | WP_065124802.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain SRCM102024 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 861352..907516 | 872960..873406 | within | 0 |
Gene organization within MGE regions
Location: 861352..907516
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSQ91_RS04105 (PSQ91_04105) | fabI | 861352..862110 (+) | 759 | WP_065124813.1 | enoyl-ACP reductase FabI | - |
| PSQ91_RS04110 (PSQ91_04110) | - | 862239..862565 (-) | 327 | WP_332452363.1 | tyrosine-type recombinase/integrase | - |
| PSQ91_RS04115 (PSQ91_04115) | - | 862502..863413 (-) | 912 | WP_232457162.1 | integrase | - |
| PSQ91_RS04120 (PSQ91_04120) | - | 863511..864317 (-) | 807 | WP_065124812.1 | DUF3037 domain-containing protein | - |
| PSQ91_RS04125 (PSQ91_04125) | - | 864319..865170 (-) | 852 | WP_144235586.1 | HipA family kinase | - |
| PSQ91_RS04130 (PSQ91_04130) | - | 865185..866381 (-) | 1197 | WP_081276412.1 | Ltp family lipoprotein | - |
| PSQ91_RS04135 (PSQ91_04135) | - | 866454..866861 (-) | 408 | WP_065124811.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PSQ91_RS04140 (PSQ91_04140) | - | 866873..867235 (-) | 363 | WP_008840853.1 | helix-turn-helix domain-containing protein | - |
| PSQ91_RS04145 (PSQ91_04145) | - | 867378..867608 (+) | 231 | WP_065124810.1 | helix-turn-helix transcriptional regulator | - |
| PSQ91_RS04150 (PSQ91_04150) | - | 867605..867742 (+) | 138 | WP_008840855.1 | hypothetical protein | - |
| PSQ91_RS04155 (PSQ91_04155) | - | 867745..867969 (-) | 225 | WP_065124809.1 | hypothetical protein | - |
| PSQ91_RS04160 (PSQ91_04160) | - | 868036..868251 (+) | 216 | WP_065124808.1 | hypothetical protein | - |
| PSQ91_RS04165 (PSQ91_04165) | - | 868336..868800 (+) | 465 | WP_232457163.1 | helix-turn-helix domain-containing protein | - |
| PSQ91_RS04170 (PSQ91_04170) | - | 868801..869082 (+) | 282 | WP_065124807.1 | hypothetical protein | - |
| PSQ91_RS04175 (PSQ91_04175) | - | 869084..869227 (+) | 144 | WP_157420393.1 | hypothetical protein | - |
| PSQ91_RS04180 (PSQ91_04180) | - | 869320..870213 (+) | 894 | WP_065124806.1 | DUF1351 domain-containing protein | - |
| PSQ91_RS04185 (PSQ91_04185) | - | 870216..871052 (+) | 837 | WP_065124805.1 | ERF family protein | - |
| PSQ91_RS04190 (PSQ91_04190) | - | 871045..871878 (+) | 834 | WP_065124804.1 | helix-turn-helix domain-containing protein | - |
| PSQ91_RS04195 (PSQ91_04195) | - | 871883..872605 (+) | 723 | WP_021361655.1 | putative HNHc nuclease | - |
| PSQ91_RS04200 (PSQ91_04200) | - | 872562..872957 (+) | 396 | WP_157421136.1 | hypothetical protein | - |
| PSQ91_RS04205 (PSQ91_04205) | ssb | 872960..873406 (+) | 447 | WP_065124802.1 | single-stranded DNA-binding protein | Machinery gene |
| PSQ91_RS04210 (PSQ91_04210) | - | 873417..873764 (+) | 348 | WP_065124801.1 | DUF1642 domain-containing protein | - |
| PSQ91_RS04215 (PSQ91_04215) | - | 873761..873985 (+) | 225 | WP_065124800.1 | hypothetical protein | - |
| PSQ91_RS04220 (PSQ91_04220) | - | 874005..874163 (+) | 159 | WP_153903504.1 | hypothetical protein | - |
| PSQ91_RS04225 (PSQ91_04225) | - | 874503..874934 (+) | 432 | WP_065124799.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| PSQ91_RS04235 (PSQ91_04235) | - | 875547..876215 (+) | 669 | WP_065124798.1 | hypothetical protein | - |
| PSQ91_RS04240 (PSQ91_04240) | - | 876284..876970 (+) | 687 | WP_032540563.1 | terminase gpP N-terminus-related DNA-binding protein | - |
| PSQ91_RS04245 (PSQ91_04245) | - | 876954..878267 (+) | 1314 | WP_021361666.1 | PBSX family phage terminase large subunit | - |
| PSQ91_RS04250 (PSQ91_04250) | - | 878279..879808 (+) | 1530 | WP_050585101.1 | phage portal protein | - |
| PSQ91_RS04255 (PSQ91_04255) | - | 879823..880938 (+) | 1116 | WP_065124824.1 | phage minor capsid protein | - |
| PSQ91_RS04260 (PSQ91_04260) | - | 881038..881610 (+) | 573 | WP_021361667.1 | phage scaffolding protein | - |
| PSQ91_RS04265 (PSQ91_04265) | - | 881623..882492 (+) | 870 | WP_065124797.1 | capsid protein | - |
| PSQ91_RS04270 (PSQ91_04270) | - | 882563..882979 (+) | 417 | WP_065124796.1 | hypothetical protein | - |
| PSQ91_RS04275 (PSQ91_04275) | - | 882976..883326 (+) | 351 | WP_065124795.1 | putative minor capsid protein | - |
| PSQ91_RS04280 (PSQ91_04280) | - | 883326..883670 (+) | 345 | WP_065124794.1 | minor capsid protein | - |
| PSQ91_RS04285 (PSQ91_04285) | - | 883670..884065 (+) | 396 | WP_065124793.1 | phage tail terminator protein | - |
| PSQ91_RS04290 (PSQ91_04290) | - | 884189..884620 (+) | 432 | Protein_819 | phage tail tube protein | - |
| PSQ91_RS04295 (PSQ91_04295) | - | 884694..885161 (+) | 468 | WP_065124791.1 | Ig-like domain-containing protein | - |
| PSQ91_RS04300 (PSQ91_04300) | - | 885237..885629 (+) | 393 | WP_065124790.1 | hypothetical protein | - |
| PSQ91_RS04305 (PSQ91_04305) | - | 885639..886259 (+) | 621 | WP_065124789.1 | Gp15 family bacteriophage protein | - |
| PSQ91_RS04310 (PSQ91_04310) | - | 886293..891410 (+) | 5118 | WP_065124788.1 | tape measure protein | - |
| PSQ91_RS04315 (PSQ91_04315) | - | 891412..892236 (+) | 825 | WP_065124787.1 | phage tail domain-containing protein | - |
| PSQ91_RS04320 (PSQ91_04320) | - | 892248..893363 (+) | 1116 | WP_065124786.1 | prophage endopeptidase tail family protein | - |
| PSQ91_RS04325 (PSQ91_04325) | - | 893356..893586 (+) | 231 | WP_065124785.1 | hypothetical protein | - |
| PSQ91_RS04330 (PSQ91_04330) | - | 893567..893977 (+) | 411 | WP_065124784.1 | hypothetical protein | - |
| PSQ91_RS04335 (PSQ91_04335) | - | 893967..895004 (+) | 1038 | WP_065124783.1 | BppU family phage baseplate upper protein | - |
| PSQ91_RS04340 (PSQ91_04340) | - | 895017..895838 (+) | 822 | WP_065124782.1 | collagen-like protein | - |
| PSQ91_RS04345 (PSQ91_04345) | - | 895854..897344 (+) | 1491 | WP_065124781.1 | hypothetical protein | - |
| PSQ91_RS04350 (PSQ91_04350) | - | 897420..897665 (+) | 246 | WP_144235585.1 | hypothetical protein | - |
| PSQ91_RS04355 (PSQ91_04355) | - | 897665..897919 (+) | 255 | WP_065124779.1 | phage holin | - |
| PSQ91_RS04360 (PSQ91_04360) | - | 897903..899270 (+) | 1368 | WP_065124778.1 | GH25 family lysozyme | - |
| PSQ91_RS04365 (PSQ91_04365) | - | 899298..899897 (+) | 600 | WP_065124777.1 | GH25 family lysozyme | - |
| PSQ91_RS04370 (PSQ91_04370) | - | 900356..900676 (+) | 321 | WP_065124775.1 | acetyl-CoA carboxylase | - |
| PSQ91_RS04375 (PSQ91_04375) | - | 901021..901905 (-) | 885 | WP_232457164.1 | hypothetical protein | - |
| PSQ91_RS04380 (PSQ91_04380) | - | 902026..902925 (-) | 900 | WP_065124774.1 | hypothetical protein | - |
| PSQ91_RS04385 (PSQ91_04385) | - | 903622..904791 (+) | 1170 | WP_065124773.1 | hydroxymethylglutaryl-CoA synthase | - |
| PSQ91_RS04390 (PSQ91_04390) | - | 904893..905501 (-) | 609 | WP_008840876.1 | hypothetical protein | - |
| PSQ91_RS04395 (PSQ91_04395) | lexA | 905582..906211 (-) | 630 | WP_065124772.1 | transcriptional repressor LexA | - |
| PSQ91_RS04400 (PSQ91_04400) | - | 906318..906566 (+) | 249 | WP_008840877.1 | DUF896 domain-containing protein | - |
| PSQ91_RS04405 (PSQ91_04405) | - | 906636..906857 (+) | 222 | WP_002831526.1 | YneF family protein | - |
| PSQ91_RS04410 (PSQ91_04410) | - | 906869..907516 (-) | 648 | WP_002831527.1 | lysophospholipid acyltransferase family protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16646.32 Da Isoelectric Point: 5.7209
>NTDB_id=785965 PSQ91_RS04205 WP_065124802.1 872960..873406(+) (ssb) [Pediococcus acidilactici strain SRCM102024]
MINRTVLVGRLTKDPEIRYTQSGMAVANFTMAVNRQFTNANGEREADFISCIVWRKAAENFCNFTHKGSLVGIDGRIQTS
SYEKEGQRVYATQVVVDSFSLLEPKQQSQQRGQQSNASDALHNNFGQPTNNYSQNNNDFGIDDNDLPF
MINRTVLVGRLTKDPEIRYTQSGMAVANFTMAVNRQFTNANGEREADFISCIVWRKAAENFCNFTHKGSLVGIDGRIQTS
SYEKEGQRVYATQVVVDSFSLLEPKQQSQQRGQQSNASDALHNNFGQPTNNYSQNNNDFGIDDNDLPF
Nucleotide
Download Length: 447 bp
>NTDB_id=785965 PSQ91_RS04205 WP_065124802.1 872960..873406(+) (ssb) [Pediococcus acidilactici strain SRCM102024]
ATGATTAATCGAACCGTATTAGTCGGACGCCTAACCAAGGATCCAGAAATCCGTTATACCCAATCAGGGATGGCGGTGGC
CAACTTTACTATGGCCGTGAACCGGCAGTTCACCAACGCTAATGGCGAGCGAGAAGCGGACTTTATCAGCTGTATTGTCT
GGAGAAAGGCGGCCGAAAACTTCTGTAATTTTACCCACAAAGGATCATTGGTCGGGATTGATGGTCGGATTCAAACTAGT
TCGTACGAAAAGGAAGGTCAACGCGTGTATGCTACACAAGTGGTTGTAGATAGTTTCTCGTTGCTTGAACCAAAGCAACA
AAGCCAACAACGTGGCCAGCAATCCAACGCTAGCGATGCTTTGCATAACAATTTCGGACAACCTACTAACAATTATAGCC
AGAATAATAACGATTTCGGCATCGACGATAATGATTTGCCGTTTTAG
ATGATTAATCGAACCGTATTAGTCGGACGCCTAACCAAGGATCCAGAAATCCGTTATACCCAATCAGGGATGGCGGTGGC
CAACTTTACTATGGCCGTGAACCGGCAGTTCACCAACGCTAATGGCGAGCGAGAAGCGGACTTTATCAGCTGTATTGTCT
GGAGAAAGGCGGCCGAAAACTTCTGTAATTTTACCCACAAAGGATCATTGGTCGGGATTGATGGTCGGATTCAAACTAGT
TCGTACGAAAAGGAAGGTCAACGCGTGTATGCTACACAAGTGGTTGTAGATAGTTTCTCGTTGCTTGAACCAAAGCAACA
AAGCCAACAACGTGGCCAGCAATCCAACGCTAGCGATGCTTTGCATAACAATTTCGGACAACCTACTAACAATTATAGCC
AGAATAATAACGATTTCGGCATCGACGATAATGATTTGCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.706 |
100 |
0.628 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
48.837 |
100 |
0.568 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.455 |
74.324 |
0.412 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
38.514 |
100 |
0.385 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
37.838 |
100 |
0.378 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
37.838 |
100 |
0.378 |
| ssb | Vibrio cholerae strain A1552 |
31.977 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.162 |
100 |
0.372 |