Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | PQQ26_RS07785 | Genome accession | NZ_CP117230 |
| Coordinates | 1605198..1605509 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472257.1 | Uniprot ID | A0A115HMG3 |
| Organism | Staphylococcus aureus strain ATCC 25923 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1600198..1610509
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ26_RS07750 (PQQ26_07750) | gcvPA | 1600700..1602046 (-) | 1347 | WP_000019697.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| PQQ26_RS07755 (PQQ26_07755) | gcvT | 1602066..1603157 (-) | 1092 | WP_000093347.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| PQQ26_RS07760 (PQQ26_07760) | - | 1603316..1603840 (-) | 525 | WP_001015125.1 | shikimate kinase | - |
| PQQ26_RS07765 (PQQ26_07765) | - | 1603830..1603976 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| PQQ26_RS07770 (PQQ26_07770) | comGF | 1604073..1604570 (-) | 498 | WP_001794328.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| PQQ26_RS07775 (PQQ26_07775) | comGE | 1604488..1604787 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| PQQ26_RS07780 (PQQ26_07780) | comGD | 1604774..1605220 (-) | 447 | WP_001791207.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| PQQ26_RS07785 (PQQ26_07785) | comGC | 1605198..1605509 (-) | 312 | WP_000472257.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| PQQ26_RS07790 (PQQ26_07790) | comGB | 1605523..1606593 (-) | 1071 | WP_000776412.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| PQQ26_RS07795 (PQQ26_07795) | comGA | 1606565..1607539 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| PQQ26_RS07800 (PQQ26_07800) | - | 1607591..1608214 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| PQQ26_RS07805 (PQQ26_07805) | - | 1608211..1608540 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| PQQ26_RS07810 (PQQ26_07810) | - | 1608540..1609526 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| PQQ26_RS07815 (PQQ26_07815) | - | 1609523..1609726 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11373.39 Da Isoelectric Point: 7.8600
>NTDB_id=782953 PQQ26_RS07785 WP_000472257.1 1605198..1605509(-) (comGC) [Staphylococcus aureus strain ATCC 25923]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEEQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEEQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=782953 PQQ26_RS07785 WP_000472257.1 1605198..1605509(-) (comGC) [Staphylococcus aureus strain ATCC 25923]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGAGCAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGAGCAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus N315 |
99.029 |
100 |
0.99 |
| comGC | Staphylococcus aureus MW2 |
99.029 |
100 |
0.99 |
| comGC/cglC | Streptococcus mitis SK321 |
48.039 |
99.029 |
0.476 |
| comGC/cglC | Streptococcus pneumoniae R6 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus pneumoniae D39 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
52.326 |
83.495 |
0.437 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comYC | Streptococcus mutans UA140 |
50 |
73.786 |
0.369 |
| comYC | Streptococcus mutans UA159 |
50 |
73.786 |
0.369 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |