Detailed information NTG0782457

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: PQ615_RS08320
• Genome accession: NZ_CP117058
• Coordinates: 1756825..1757151 (-)
• Length: 108 a.a.
• NCBI ID: WP_003098806.1
• Uniprot ID: -
• Organism: Streptococcus iniae strain LSSM211007SI
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1751825..1762151

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PQ615_RS08280 (PQ615_08280)	-	1752359..1752811 (-)	453	WP_003098820.1	hypothetical protein	-
PQ615_RS08285 (PQ615_08285)	-	1752824..1753027 (-)	204	WP_003098819.1	helix-turn-helix transcriptional regulator	-
PQ615_RS08290 (PQ615_08290)	-	1753149..1754345 (-)	1197	WP_003098816.1	acetate kinase	-
PQ615_RS08295 (PQ615_08295)	comYH	1754402..1755358 (-)	957	WP_003098815.1	class I SAM-dependent methyltransferase	Machinery gene
PQ615_RS08300 (PQ615_08300)	comGG	1755420..1755773 (-)	354	WP_003098812.1	competence type IV pilus minor pilin ComGG	-
PQ615_RS08305 (PQ615_08305)	comYF	1755763..1756212 (-)	450	WP_119773875.1	competence type IV pilus minor pilin ComGF	Machinery gene
PQ615_RS08310 (PQ615_08310)	comGE	1756172..1756465 (-)	294	WP_031239176.1	competence type IV pilus minor pilin ComGE	-
PQ615_RS08315 (PQ615_08315)	comGD	1756437..1756865 (-)	429	WP_003098807.1	competence type IV pilus minor pilin ComGD	-
PQ615_RS08320 (PQ615_08320)	comGC/cglC	1756825..1757151 (-)	327	WP_003098806.1	competence type IV pilus major pilin ComGC	Machinery gene
PQ615_RS08325 (PQ615_08325)	comYB	1757152..1758168 (-)	1017	WP_003098804.1	competence type IV pilus assembly protein ComGB	Machinery gene
PQ615_RS08330 (PQ615_08330)	comYA	1758119..1759060 (-)	942	WP_003098801.1	competence type IV pilus ATPase ComGA	Machinery gene
PQ615_RS08335 (PQ615_08335)	-	1759121..1759486 (-)	366	WP_003098799.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12153.19 Da
• Isoelectric Point: 10.0312

>NTDB_id=782457 PQ615_RS08320 WP_003098806.1 1756825..1757151(-) (comGC/cglC) [Streptococcus iniae strain LSSM211007SI]
MKTKCKQLKESRTKAFTLLEMLIVLLIISVLMLLFIPNLSKQKDKVTDAGNAAVVKIVENQAELYELTEGGKASLAQLQS
KGHITDKQAKAYQDYYAKNSDKHRQVNN

Nucleotide

• Length: 327 bp

>NTDB_id=782457 PQ615_RS08320 WP_003098806.1 1756825..1757151(-) (comGC/cglC) [Streptococcus iniae strain LSSM211007SI]
ATGAAAACAAAATGTAAACAACTAAAAGAAAGCCGTACTAAAGCTTTCACACTTCTAGAAATGTTGATTGTTTTGCTAAT
TATTAGTGTTCTTATGCTACTGTTTATTCCGAATTTAAGTAAGCAAAAAGATAAGGTTACAGATGCTGGTAATGCTGCAG
TGGTTAAAATTGTTGAAAATCAGGCGGAACTATATGAATTAACGGAAGGTGGGAAAGCAAGCCTCGCTCAACTCCAATCA
AAAGGTCATATTACAGACAAACAAGCGAAGGCTTATCAGGATTATTATGCCAAAAACAGTGACAAGCATAGACAAGTTAA
CAACTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (12-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus pneumoniae TIGR4	59.259	100	0.593
comGC/cglC	Streptococcus pneumoniae D39	59.259	100	0.593
comGC/cglC	Streptococcus pneumoniae R6	59.259	100	0.593
comGC/cglC	Streptococcus pneumoniae Rx1	59.259	100	0.593
comGC/cglC	Streptococcus mitis SK321	63.366	93.519	0.593
comYC	Streptococcus gordonii str. Challis substr. CH1	61.165	95.37	0.583
comYC	Streptococcus mutans UA140	59.223	95.37	0.565
comYC	Streptococcus mutans UA159	59.223	95.37	0.565
comGC/cglC	Streptococcus mitis NCTC 12261	64.835	84.259	0.546
comGC	Lactococcus lactis subsp. cremoris KW2	51.376	100	0.519
comYC	Streptococcus suis isolate S10	60.92	80.556	0.491