Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | LOY12_RS06265 | Genome accession | NZ_CP116909 |
| Coordinates | 1193996..1194307 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain AATYW | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1188996..1199307
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LOY12_RS06235 (LOY12_006235) | - | 1189779..1189982 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| LOY12_RS06240 (LOY12_006240) | - | 1189979..1190965 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| LOY12_RS06245 (LOY12_006245) | - | 1190965..1191294 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| LOY12_RS06250 (LOY12_006250) | - | 1191291..1191914 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| LOY12_RS06255 (LOY12_006255) | comGA | 1191966..1192940 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| LOY12_RS06260 (LOY12_006260) | comGB | 1192912..1193982 (+) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LOY12_RS06265 (LOY12_006265) | comGC | 1193996..1194307 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LOY12_RS06270 (LOY12_006270) | comGD | 1194285..1194731 (+) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LOY12_RS06275 (LOY12_006275) | comGE | 1194718..1195017 (+) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| LOY12_RS06280 (LOY12_006280) | comGF | 1194935..1195432 (+) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LOY12_RS06285 (LOY12_006285) | - | 1195529..1195675 (+) | 147 | WP_001792109.1 | hypothetical protein | - |
| LOY12_RS06290 (LOY12_006290) | - | 1195665..1196189 (+) | 525 | WP_001015120.1 | shikimate kinase | - |
| LOY12_RS06295 (LOY12_006295) | gcvT | 1196348..1197439 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| LOY12_RS06300 (LOY12_006300) | gcvPA | 1197459..1198805 (+) | 1347 | WP_000019691.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=781107 LOY12_RS06265 WP_000472256.1 1193996..1194307(+) (comGC) [Staphylococcus aureus strain AATYW]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=781107 LOY12_RS06265 WP_000472256.1 1193996..1194307(+) (comGC) [Staphylococcus aureus strain AATYW]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |