NTDB

Overview

Name	ssbA	Type	Machinery gene
Locus tag	PND17_RS04685	Genome accession	NZ_CP116772
Coordinates	873669..874061 (+)	Length	130 a.a.
NCBI ID	WP_180473347.1	Uniprot ID	-
Organism	Streptococcus thermophilus strain strain TSGB 4141
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 868669..879061

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PND17_RS04650 (PND17_04650)	proC	868872..869642 (-)	771	WP_011226616.1	pyrroline-5-carboxylate reductase	-
PND17_RS04655 (PND17_04655)	pepA	869658..870725 (-)	1068	WP_002952022.1	glutamyl aminopeptidase	-
PND17_RS04660 (PND17_04660)	-	870825..871109 (+)	285	WP_011681678.1	DUF4651 domain-containing protein	-
PND17_RS04665 (PND17_04665)	-	871106..871420 (+)	315	WP_002945230.1	thioredoxin family protein	-
PND17_RS04670 (PND17_04670)	ytpR	871430..872053 (+)	624	WP_002952017.1	YtpR family tRNA-binding protein	-
PND17_RS04675 (PND17_04675)	-	872191..873222 (+)	1032	WP_180473348.1	YeeE/YedE family protein	-
PND17_RS04680 (PND17_04680)	-	873237..873464 (+)	228	WP_011226611.1	sulfurtransferase TusA family protein	-
PND17_RS04685 (PND17_04685)	ssbA	873669..874061 (+)	393	WP_180473347.1	single-stranded DNA-binding protein	Machinery gene
PND17_RS04690 (PND17_04690)	tadA	874822..875340 (+)	519	WP_271298284.1	tRNA adenosine(34) deaminase TadA	-
PND17_RS09995	-	875421..875684 (-)	264	WP_011681674.1	hypothetical protein	-
PND17_RS04695 (PND17_04695)	-	875737..875904 (-)	168	WP_141326590.1	class IIb bacteriocin, lactobin A/cerein 7B family	-
PND17_RS04705 (PND17_04705)	-	876273..877106 (+)	834	WP_271298283.1	putative RNA methyltransferase	-
PND17_RS10000	-	877221..877975 (+)	755	Protein_929	HAD family hydrolase	-
PND17_RS04720 (PND17_04720)	dapD	878061..878759 (+)	699	WP_002951996.1	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	-

Sequence

Protein

Download Length: 130 a.a. Molecular weight: 14759.67 Da Isoelectric Point: 5.9220

                                >NTDB_id=780043 PND17_RS04685 WP_180473347.1 873669..874061(+) (ssbA) [Streptococcus thermophilus strain strain TSGB 4141]

MYNKVILIGRLTATPEMVKTASDRSFTRVTVAVNRRYKTQNGEREADFITVVVWGRLADTLASYASKGSLISLDGEIRTR

KYDKDGQTHYVTEVLCSSFQLLESRAQRAVRENNPDNDLADLILEEELPF

Nucleotide

Download Length: 393 bp

                                >NTDB_id=780043 PND17_RS04685 WP_180473347.1 873669..874061(+) (ssbA) [Streptococcus thermophilus strain strain TSGB 4141]

ATGTATAACAAAGTAATTTTAATTGGACGTTTGACAGCAACACCTGAAATGGTTAAGACTGCTAGTGACAGGTCTTTTAC

ACGTGTCACAGTTGCGGTTAATCGTCGCTATAAGACGCAAAATGGTGAGCGTGAGGCTGATTTTATCACAGTAGTGGTTT

GGGGCCGTTTAGCTGATACATTGGCATCTTATGCTAGCAAGGGAAGTTTAATTTCTCTTGATGGTGAGATTCGCACTCGT

AAGTATGATAAGGATGGTCAAACTCATTACGTTACTGAAGTGCTTTGTTCCTCTTTCCAACTTCTGGAGAGTCGTGCTCA

GCGTGCTGTTAGGGAAAATAATCCTGACAATGACTTGGCTGACCTGATTTTAGAAGAAGAGCTTCCCTTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-102)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbA	Streptococcus mutans UA159	78.626	100	0.792
ssbB	Streptococcus sobrinus strain NIDR 6715-7	75.573	100	0.762
ssbB/cilA	Streptococcus pneumoniae TIGR4	74.046	100	0.746
ssbB/cilA	Streptococcus mitis SK321	73.282	100	0.738
ssbB/cilA	Streptococcus pneumoniae R6	73.282	100	0.738
ssbB/cilA	Streptococcus pneumoniae Rx1	73.282	100	0.738
ssbB/cilA	Streptococcus pneumoniae D39	73.282	100	0.738
ssbB/cilA	Streptococcus mitis NCTC 12261	71.756	100	0.723
ssbB	Lactococcus lactis subsp. cremoris KW2	61.607	86.154	0.531
ssbA	Bacillus subtilis subsp. subtilis str. 168	46.226	81.538	0.377
ssb	Latilactobacillus sakei subsp. sakei 23K	45.283	81.538	0.369

Detailed information NTG0780043