Detailed information NTG0778161

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: QYH60_RS03810
• Genome accession: NZ_CP129292
• Coordinates: 743676..743972 (+)
• Length: 98 a.a.
• NCBI ID: WP_167593410.1
• Uniprot ID: -
• Organism: Lactococcus lactis subsp. lactis strain KMGR2-43
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 738676..748972

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QYH60_RS03780 (QYH60_03780)	-	740747..741160 (+)	414	WP_301401349.1	DUF1617 family protein	-
QYH60_RS03785 (QYH60_03785)	-	741162..741389 (+)	228	WP_301401351.1	hypothetical protein	-
QYH60_RS03790 (QYH60_03790)	-	741414..741638 (+)	225	WP_010905920.1	hemolysin XhlA family protein	-
QYH60_RS03795 (QYH60_03795)	-	741652..741939 (+)	288	WP_301401353.1	phage holin	-
QYH60_RS03800 (QYH60_03800)	-	741939..742718 (+)	780	WP_301401355.1	peptidoglycan amidohydrolase family protein	-
QYH60_RS03805 (QYH60_03805)	-	742796..743515 (+)	720	WP_301401357.1	hypothetical protein	-
QYH60_RS03810 (QYH60_03810)	comGC	743676..743972 (+)	297	WP_167593410.1	competence type IV pilus major pilin ComGC	Machinery gene
QYH60_RS03815 (QYH60_03815)	comGD	744007..744363 (+)	357	WP_301401359.1	competence type IV pilus minor pilin ComGD	Machinery gene
QYH60_RS03820 (QYH60_03820)	comGE	744335..744631 (+)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
QYH60_RS03825 (QYH60_03825)	comGF	744594..745040 (+)	447	WP_029344525.1	competence type IV pilus minor pilin ComGF	Machinery gene
QYH60_RS03830 (QYH60_03830)	comGG	745079..745363 (+)	285	WP_025017139.1	competence type IV pilus minor pilin ComGG	Machinery gene
QYH60_RS03835 (QYH60_03835)	-	745445..745882 (+)	438	WP_003129992.1	zinc-dependent MarR family transcriptional regulator	-
QYH60_RS03840 (QYH60_03840)	-	745879..746721 (+)	843	WP_015427160.1	metal ABC transporter substrate-binding protein	-
QYH60_RS03845 (QYH60_03845)	-	746898..747635 (+)	738	WP_012898617.1	metal ABC transporter ATP-binding protein	-
QYH60_RS03850 (QYH60_03850)	-	747628..748437 (+)	810	WP_014570791.1	metal ABC transporter permease	-

Sequence

Protein

• Length: 98 a.a.
• Molecular weight: 11174.83 Da
• Isoelectric Point: 4.2213

>NTDB_id=778161 QYH60_RS03810 WP_167593410.1 743676..743972(+) (comGC) [Lactococcus lactis subsp. lactis strain KMGR2-43]
MSFLVTLIEMLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLSELLNAGMITQKQIS
AYDNYYDQNKNEERNFND

Nucleotide

• Length: 297 bp

>NTDB_id=778161 QYH60_RS03810 WP_167593410.1 743676..743972(+) (comGC) [Lactococcus lactis subsp. lactis strain KMGR2-43]
ATGAGTTTTTTAGTTACCTTAATTGAGATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTGTTCCAAA
TTTAATTAAAGAAAAATCACAAGTTCAAAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTT
ATGAATTAGATCATGATGATGAGAAGCCGAGTCTGTCAGAATTGCTCAACGCTGGGATGATTACTCAAAAACAAATTTCT
GCTTACGATAATTACTATGATCAGAACAAAAATGAAGAACGAAATTTTAATGACTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	89.247	94.898	0.847
comGC/cglC	Streptococcus mitis SK321	54.286	100	0.582
comGC	Streptococcus mutans UA140	57.778	91.837	0.531
comGC	Streptococcus mutans UA159	57.778	91.837	0.531
comGC	Streptococcus gordonii str. Challis substr. CH1	58.427	90.816	0.531
comGC/cglC	Streptococcus mitis NCTC 12261	55.914	94.898	0.531
comGC/cglC	Streptococcus pneumoniae Rx1	55.914	94.898	0.531
comGC/cglC	Streptococcus pneumoniae D39	55.914	94.898	0.531
comGC/cglC	Streptococcus pneumoniae R6	55.914	94.898	0.531
comGC/cglC	Streptococcus pneumoniae TIGR4	55.914	94.898	0.531
comGC	Streptococcus suis isolate S10	59.74	78.571	0.469