Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   QYH60_RS03830 Genome accession   NZ_CP129292
Coordinates   745079..745363 (+) Length   94 a.a.
NCBI ID   WP_025017139.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain KMGR2-43     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 740079..750363
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QYH60_RS03780 (QYH60_03780) - 740747..741160 (+) 414 WP_301401349.1 DUF1617 family protein -
  QYH60_RS03785 (QYH60_03785) - 741162..741389 (+) 228 WP_301401351.1 hypothetical protein -
  QYH60_RS03790 (QYH60_03790) - 741414..741638 (+) 225 WP_010905920.1 hemolysin XhlA family protein -
  QYH60_RS03795 (QYH60_03795) - 741652..741939 (+) 288 WP_301401353.1 phage holin -
  QYH60_RS03800 (QYH60_03800) - 741939..742718 (+) 780 WP_301401355.1 peptidoglycan amidohydrolase family protein -
  QYH60_RS03805 (QYH60_03805) - 742796..743515 (+) 720 WP_301401357.1 hypothetical protein -
  QYH60_RS03810 (QYH60_03810) comGC 743676..743972 (+) 297 WP_167593410.1 competence type IV pilus major pilin ComGC Machinery gene
  QYH60_RS03815 (QYH60_03815) comGD 744007..744363 (+) 357 WP_301401359.1 competence type IV pilus minor pilin ComGD Machinery gene
  QYH60_RS03820 (QYH60_03820) comGE 744335..744631 (+) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  QYH60_RS03825 (QYH60_03825) comGF 744594..745040 (+) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  QYH60_RS03830 (QYH60_03830) comGG 745079..745363 (+) 285 WP_025017139.1 competence type IV pilus minor pilin ComGG Machinery gene
  QYH60_RS03835 (QYH60_03835) - 745445..745882 (+) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  QYH60_RS03840 (QYH60_03840) - 745879..746721 (+) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  QYH60_RS03845 (QYH60_03845) - 746898..747635 (+) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  QYH60_RS03850 (QYH60_03850) - 747628..748437 (+) 810 WP_014570791.1 metal ABC transporter permease -
  QYH60_RS03855 (QYH60_03855) - 748475..749341 (-) 867 WP_025017140.1 RluA family pseudouridine synthase -
  QYH60_RS03860 (QYH60_03860) - 749546..749923 (+) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10813.05 Da        Isoelectric Point: 5.0604

>NTDB_id=778165 QYH60_RS03830 WP_025017139.1 745079..745363(+) (comGG) [Lactococcus lactis subsp. lactis strain KMGR2-43]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGTNFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=778165 QYH60_RS03830 WP_025017139.1 745079..745363(+) (comGG) [Lactococcus lactis subsp. lactis strain KMGR2-43]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGGGATT
TGTCCTACAATTTACTGACAGACTCGTCAGCTAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCACAAACTTTCAAATAAAAAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585