NTDB

Overview

Name	ssb	Type	Machinery gene
Locus tag	PAA20_RS00635	Genome accession	NZ_CP115448
Coordinates	110877..111314 (-)	Length	145 a.a.
NCBI ID	WP_011098432.1	Uniprot ID	A0A4Q0VB51
Organism	Clostridium tetani strain CMCC64008
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 105877..116314

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PAA20_RS00610 (PAA20_00610)	rplI	106636..107079 (-)	444	WP_011098436.1	50S ribosomal protein L9	-
PAA20_RS00615 (PAA20_00615)	-	107076..109070 (-)	1995	WP_035141195.1	DHH family phosphoesterase	-
PAA20_RS00620 (PAA20_00620)	-	109083..110072 (-)	990	WP_011098434.1	YybS family protein	-
PAA20_RS00625 (PAA20_00625)	-	110086..110403 (-)	318	WP_011098433.1	MazG-like family protein	-
PAA20_RS00630 (PAA20_00630)	rpsR	110590..110856 (-)	267	WP_023436916.1	30S ribosomal protein S18	-
PAA20_RS00635 (PAA20_00635)	ssb	110877..111314 (-)	438	WP_011098432.1	single-stranded DNA-binding protein	Machinery gene
PAA20_RS00640 (PAA20_00640)	rpsF	111330..111614 (-)	285	WP_023436913.1	30S ribosomal protein S6	-
PAA20_RS00645 (PAA20_00645)	-	111712..111912 (-)	201	WP_035141192.1	DUF951 domain-containing protein	-
PAA20_RS00650 (PAA20_00650)	-	111905..112789 (-)	885	WP_115606164.1	mechanosensitive ion channel family protein	-
PAA20_RS00655 (PAA20_00655)	ytvI	113026..114081 (+)	1056	WP_011098430.1	sporulation integral membrane protein YtvI	-
PAA20_RS00660 (PAA20_00660)	yyaC	114137..114712 (+)	576	WP_011098429.1	spore protease YyaC	-
PAA20_RS00665 (PAA20_00665)	-	114734..115231 (-)	498	WP_011098428.1	DUF4446 family protein	-
PAA20_RS00670 (PAA20_00670)	-	115271..116128 (-)	858	WP_115606166.1	ParB/RepB/Spo0J family partition protein	-

Sequence

Protein

Download Length: 145 a.a. Molecular weight: 16180.96 Da Isoelectric Point: 4.6708

                                >NTDB_id=772136 PAA20_RS00635 WP_011098432.1 110877..111314(-) (ssb) [Clostridium tetani strain CMCC64008]

MNRVVLIGRLTKDPELKFTPGTGTAVTTFVLAVDRRFSKDGKNEADFIPVVVWGKQAESTANYMSKGKLIGISGRIQTRS

YEAKDGTRRYVTEVVADEVKFLEWGNKQSSGSQGFNNFESDPLSYNNEDNYNDDITPVDEGEVPF

Nucleotide

Download Length: 438 bp

                                >NTDB_id=772136 PAA20_RS00635 WP_011098432.1 110877..111314(-) (ssb) [Clostridium tetani strain CMCC64008]

ATGAATCGTGTAGTCTTAATTGGAAGGCTTACAAAAGATCCTGAATTAAAGTTTACTCCGGGAACAGGAACAGCTGTAAC

TACTTTTGTTTTAGCTGTAGATAGAAGGTTTTCCAAAGATGGAAAAAATGAAGCTGACTTTATCCCTGTAGTAGTATGGG

GAAAACAGGCAGAATCAACAGCTAATTATATGAGTAAGGGTAAACTTATTGGAATTAGTGGAAGAATTCAAACTAGAAGT

TATGAGGCTAAAGATGGCACTAGAAGATATGTTACAGAAGTTGTAGCAGATGAGGTTAAATTCCTAGAATGGGGAAATAA

ACAGTCATCAGGTTCTCAAGGCTTTAATAATTTTGAATCAGATCCACTAAGTTATAATAATGAAGATAATTACAATGATG

ATATAACTCCTGTGGACGAAGGAGAAGTTCCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(1-102)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A4Q0VB51

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssb	Latilactobacillus sakei subsp. sakei 23K	42.262	100	0.49
ssbA	Bacillus subtilis subsp. subtilis str. 168	57.265	80.69	0.462
ssbB	Streptococcus sobrinus strain NIDR 6715-7	42.857	100	0.434
ssbA	Streptococcus mutans UA159	41.379	100	0.414
ssbB/cilA	Streptococcus mitis NCTC 12261	38.095	100	0.386
ssbB/cilA	Streptococcus pneumoniae TIGR4	37.415	100	0.379
ssbB	Bacillus subtilis subsp. subtilis str. 168	53.398	71.034	0.379
ssbB/cilA	Streptococcus pneumoniae Rx1	36.735	100	0.372
ssbB/cilA	Streptococcus pneumoniae D39	36.735	100	0.372
ssbB/cilA	Streptococcus pneumoniae R6	36.735	100	0.372
ssbB/cilA	Streptococcus mitis SK321	36.735	100	0.372

Detailed information NTG0772136