Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | OTU47_RS03755 | Genome accession | NZ_CP113115 |
| Coordinates | 712241..712507 (+) | Length | 88 a.a. |
| NCBI ID | WP_050073122.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain NP2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 673403..711750 | 712241..712507 | flank | 491 |
Gene organization within MGE regions
Location: 673403..712507
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OTU47_RS03460 (OTU47_03460) | - | 674357..675802 (-) | 1446 | WP_267748066.1 | recombinase family protein | - |
| OTU47_RS03465 (OTU47_03465) | - | 675976..676176 (-) | 201 | WP_000064302.1 | hypothetical protein | - |
| OTU47_RS03470 (OTU47_03470) | - | 676178..676966 (-) | 789 | WP_050116194.1 | helix-turn-helix domain-containing protein | - |
| OTU47_RS03475 (OTU47_03475) | - | 677121..677396 (+) | 276 | WP_001094375.1 | hypothetical protein | - |
| OTU47_RS03480 (OTU47_03480) | - | 677471..677638 (+) | 168 | WP_267748061.1 | hypothetical protein | - |
| OTU47_RS03485 (OTU47_03485) | - | 677629..678078 (-) | 450 | WP_001058908.1 | hypothetical protein | - |
| OTU47_RS03490 (OTU47_03490) | - | 678277..678567 (+) | 291 | WP_001815531.1 | hypothetical protein | - |
| OTU47_RS03495 (OTU47_03495) | - | 678759..678947 (+) | 189 | WP_001161207.1 | helix-turn-helix transcriptional regulator | - |
| OTU47_RS03500 (OTU47_03500) | - | 679601..679804 (+) | 204 | WP_001247820.1 | hypothetical protein | - |
| OTU47_RS03505 (OTU47_03505) | - | 679828..680544 (+) | 717 | WP_001004043.1 | phage antirepressor KilAC domain-containing protein | - |
| OTU47_RS03510 (OTU47_03510) | - | 680616..680774 (+) | 159 | WP_180384356.1 | BOW99_gp33 family protein | - |
| OTU47_RS03515 (OTU47_03515) | - | 680778..680900 (+) | 123 | Protein_674 | DNA-binding protein | - |
| OTU47_RS03520 (OTU47_03520) | - | 680986..681306 (+) | 321 | WP_000462831.1 | hypothetical protein | - |
| OTU47_RS03525 (OTU47_03525) | - | 681322..681618 (+) | 297 | WP_000391807.1 | hypothetical protein | - |
| OTU47_RS03530 (OTU47_03530) | - | 681611..682417 (+) | 807 | WP_267748048.1 | phage replisome organizer N-terminal domain-containing protein | - |
| OTU47_RS03535 (OTU47_03535) | - | 682405..682563 (+) | 159 | WP_000511761.1 | hypothetical protein | - |
| OTU47_RS03540 (OTU47_03540) | - | 682557..683327 (+) | 771 | WP_000228210.1 | ATP-binding protein | - |
| OTU47_RS03545 (OTU47_03545) | - | 683342..683536 (+) | 195 | WP_000470303.1 | hypothetical protein | - |
| OTU47_RS03550 (OTU47_03550) | - | 683536..683754 (+) | 219 | WP_000891962.1 | hypothetical protein | - |
| OTU47_RS03555 (OTU47_03555) | - | 683754..684059 (+) | 306 | WP_001097109.1 | hypothetical protein | - |
| OTU47_RS03560 (OTU47_03560) | - | 684150..684317 (+) | 168 | WP_267748031.1 | hypothetical protein | - |
| OTU47_RS03565 (OTU47_03565) | - | 684304..684513 (+) | 210 | WP_000872731.1 | hypothetical protein | - |
| OTU47_RS03570 (OTU47_03570) | - | 684485..684802 (+) | 318 | WP_180372348.1 | hypothetical protein | - |
| OTU47_RS03575 (OTU47_03575) | - | 684804..685304 (+) | 501 | WP_001041165.1 | DUF1642 domain-containing protein | - |
| OTU47_RS03580 (OTU47_03580) | - | 685297..685899 (+) | 603 | WP_050254358.1 | DUF1642 domain-containing protein | - |
| OTU47_RS03585 (OTU47_03585) | - | 685883..686170 (+) | 288 | WP_050217665.1 | hypothetical protein | - |
| OTU47_RS03590 (OTU47_03590) | - | 686252..686530 (+) | 279 | WP_001813036.1 | hypothetical protein | - |
| OTU47_RS03595 (OTU47_03595) | - | 686542..687063 (+) | 522 | WP_050254359.1 | YopX family protein | - |
| OTU47_RS03600 (OTU47_03600) | - | 687079..687315 (+) | 237 | WP_001067627.1 | DUF3310 domain-containing protein | - |
| OTU47_RS03605 (OTU47_03605) | - | 687308..687484 (+) | 177 | WP_000005959.1 | hypothetical protein | - |
| OTU47_RS03610 (OTU47_03610) | - | 687477..687665 (+) | 189 | WP_050240803.1 | multiprotein-bridging factor 1 family protein | - |
| OTU47_RS03615 (OTU47_03615) | - | 687678..688106 (+) | 429 | WP_050216380.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| OTU47_RS03620 (OTU47_03620) | - | 688396..688962 (+) | 567 | WP_061634575.1 | site-specific integrase | - |
| OTU47_RS03625 (OTU47_03625) | - | 689196..689540 (+) | 345 | WP_001095652.1 | HNH endonuclease | - |
| OTU47_RS03630 (OTU47_03630) | - | 689677..690981 (+) | 1305 | WP_267748013.1 | hypothetical protein | - |
| OTU47_RS03635 (OTU47_03635) | - | 690935..692170 (+) | 1236 | WP_267748011.1 | hypothetical protein | - |
| OTU47_RS03640 (OTU47_03640) | - | 692157..692384 (+) | 228 | WP_050254362.1 | hypothetical protein | - |
| OTU47_RS03645 (OTU47_03645) | - | 692434..692664 (+) | 231 | WP_050254363.1 | hypothetical protein | - |
| OTU47_RS03650 (OTU47_03650) | - | 692715..694127 (+) | 1413 | WP_267748008.1 | DEAD/DEAH box helicase family protein | - |
| OTU47_RS03655 (OTU47_03655) | - | 694209..694673 (+) | 465 | WP_050254365.1 | DUF4355 domain-containing protein | - |
| OTU47_RS03660 (OTU47_03660) | - | 694679..695578 (+) | 900 | WP_267748004.1 | phage major capsid protein | - |
| OTU47_RS03665 (OTU47_03665) | - | 695584..695796 (+) | 213 | WP_001240369.1 | HeH/LEM domain-containing protein | - |
| OTU47_RS03670 (OTU47_03670) | - | 695800..696240 (+) | 441 | WP_267748001.1 | phage Gp19/Gp15/Gp42 family protein | - |
| OTU47_RS03675 (OTU47_03675) | - | 696185..696523 (+) | 339 | WP_000221695.1 | hypothetical protein | - |
| OTU47_RS03680 (OTU47_03680) | - | 696516..696752 (+) | 237 | WP_000069060.1 | hypothetical protein | - |
| OTU47_RS03685 (OTU47_03685) | - | 696749..697084 (+) | 336 | WP_000571659.1 | hypothetical protein | - |
| OTU47_RS03690 (OTU47_03690) | - | 697151..697708 (+) | 558 | WP_050254374.1 | hypothetical protein | - |
| OTU47_RS03695 (OTU47_03695) | - | 697714..697989 (+) | 276 | WP_000391234.1 | hypothetical protein | - |
| OTU47_RS03700 (OTU47_03700) | - | 698001..698387 (+) | 387 | WP_000560880.1 | DUF5361 domain-containing protein | - |
| OTU47_RS03705 (OTU47_03705) | - | 698387..700852 (+) | 2466 | WP_050228208.1 | hypothetical protein | - |
| OTU47_RS03710 (OTU47_03710) | - | 700852..701550 (+) | 699 | WP_000499607.1 | adenylosuccinate synthetase | - |
| OTU47_RS03715 (OTU47_03715) | - | 701547..709496 (+) | 7950 | WP_267747982.1 | phage tail spike protein | - |
| OTU47_RS03720 (OTU47_03720) | - | 709493..709609 (+) | 117 | WP_001063632.1 | hypothetical protein | - |
| OTU47_RS03725 (OTU47_03725) | - | 709590..709793 (+) | 204 | WP_001091107.1 | hypothetical protein | - |
| OTU47_RS03730 (OTU47_03730) | - | 709796..710146 (+) | 351 | WP_054368148.1 | hypothetical protein | - |
| OTU47_RS03735 (OTU47_03735) | - | 710156..710455 (+) | 300 | WP_001811580.1 | hypothetical protein | - |
| OTU47_RS03740 (OTU47_03740) | - | 710459..710794 (+) | 336 | WP_001186204.1 | phage holin | - |
| OTU47_RS03745 (OTU47_03745) | lytA | 710794..711750 (+) | 957 | WP_054436120.1 | N-acetylmuramoyl-L-alanine amidase LytA | - |
| OTU47_RS03750 (OTU47_03750) | - | 711982..712239 (+) | 258 | WP_000698513.1 | hypothetical protein | - |
| OTU47_RS03755 (OTU47_03755) | comGC/cglC | 712241..712507 (+) | 267 | WP_050073122.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 88 a.a. Molecular weight: 9853.35 Da Isoelectric Point: 6.3588
>NTDB_id=760410 OTU47_RS03755 WP_050073122.1 712241..712507(+) (comGC/cglC) [Streptococcus pneumoniae strain NP2]
MLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLKEDGRITEEQAKAYKEYNDKNV
GANRKVND
MLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLKEDGRITEEQAKAYKEYNDKNV
GANRKVND
Nucleotide
Download Length: 267 bp
>NTDB_id=760410 OTU47_RS03755 WP_050073122.1 712241..712507(+) (comGC/cglC) [Streptococcus pneumoniae strain NP2]
ATGTTGGTGGTCTTGCTGATTATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAA
TGACAAAGGAAAAGCAGCTGTTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTA
GCCTAAGCAAGTTAAAAGAAGATGGACGCATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACAATGATAAAAATGTG
GGAGCAAATCGTAAAGTCAATGATTAA
ATGTTGGTGGTCTTGCTGATTATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAA
TGACAAAGGAAAAGCAGCTGTTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTA
GCCTAAGCAAGTTAAAAGAAGATGGACGCATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACAATGATAAAAATGTG
GGAGCAAATCGTAAAGTCAATGATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
95.455 |
100 |
0.955 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
94.318 |
100 |
0.943 |
| comGC/cglC | Streptococcus pneumoniae D39 |
94.318 |
100 |
0.943 |
| comGC/cglC | Streptococcus pneumoniae R6 |
94.318 |
100 |
0.943 |
| comGC/cglC | Streptococcus mitis SK321 |
90.541 |
84.091 |
0.761 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
92.188 |
72.727 |
0.67 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
71.25 |
90.909 |
0.648 |
| comYC | Streptococcus suis isolate S10 |
65.278 |
81.818 |
0.534 |
| comYC | Streptococcus mutans UA140 |
60 |
79.545 |
0.477 |
| comYC | Streptococcus mutans UA159 |
60 |
79.545 |
0.477 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
50.667 |
85.227 |
0.432 |
| comGC | Staphylococcus aureus MW2 |
46.377 |
78.409 |
0.364 |
| comGC | Staphylococcus aureus N315 |
46.377 |
78.409 |
0.364 |