Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | OS088_RS04055 | Genome accession | NZ_CP113051 |
| Coordinates | 798930..799358 (+) | Length | 142 a.a. |
| NCBI ID | WP_000934783.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain Viktor | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 792130..835010 | 798930..799358 | within | 0 |
Gene organization within MGE regions
Location: 792130..835010
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS088_RS03980 | - | 792130..793521 (-) | 1392 | WP_031788255.1 | recombinase family protein | - |
| OS088_RS14495 | - | 793579..793716 (-) | 138 | WP_225370885.1 | hypothetical protein | - |
| OS088_RS14500 | - | 793843..794084 (-) | 242 | Protein_774 | hypothetical protein | - |
| OS088_RS03995 | - | 794140..794325 (-) | 186 | WP_024936996.1 | hypothetical protein | - |
| OS088_RS04000 | - | 794322..794468 (-) | 147 | WP_001049401.1 | hypothetical protein | - |
| OS088_RS04005 | - | 794480..795190 (-) | 711 | WP_000094091.1 | helix-turn-helix domain-containing protein | - |
| OS088_RS04010 | - | 795361..795600 (+) | 240 | WP_000548576.1 | helix-turn-helix transcriptional regulator | - |
| OS088_RS04015 | - | 795613..796056 (+) | 444 | WP_000435355.1 | hypothetical protein | - |
| OS088_RS04020 | - | 796071..796214 (+) | 144 | WP_000939498.1 | hypothetical protein | - |
| OS088_RS04025 | - | 796204..796413 (-) | 210 | WP_000642492.1 | hypothetical protein | - |
| OS088_RS04030 | - | 796470..797183 (+) | 714 | WP_031912126.1 | BRO family protein | - |
| OS088_RS04035 | - | 797285..797446 (+) | 162 | WP_000066019.1 | DUF1270 family protein | - |
| OS088_RS04040 | - | 797538..797798 (+) | 261 | WP_031890781.1 | DUF1108 family protein | - |
| OS088_RS04045 | - | 797813..798292 (+) | 480 | WP_000002517.1 | siphovirus Gp157 family protein | - |
| OS088_RS04050 | - | 798292..798930 (+) | 639 | WP_001043063.1 | ERF family protein | - |
| OS088_RS04055 | ssbA | 798930..799358 (+) | 429 | WP_000934783.1 | single-stranded DNA-binding protein | Machinery gene |
| OS088_RS04060 | - | 799372..800055 (+) | 684 | WP_267814762.1 | putative HNHc nuclease | - |
| OS088_RS04065 | - | 800152..801000 (-) | 849 | WP_154284190.1 | DUF4393 domain-containing protein | - |
| OS088_RS04070 | - | 801065..801835 (+) | 771 | WP_267814765.1 | conserved phage C-terminal domain-containing protein | - |
| OS088_RS04075 | - | 801845..802624 (+) | 780 | WP_000803065.1 | ATP-binding protein | - |
| OS088_RS04080 | - | 802618..802779 (+) | 162 | WP_000237153.1 | hypothetical protein | - |
| OS088_RS04085 | - | 802792..803013 (+) | 222 | WP_001123673.1 | DUF3269 family protein | - |
| OS088_RS04090 | - | 803024..803428 (+) | 405 | WP_000049784.1 | DUF1064 domain-containing protein | - |
| OS088_RS04095 | - | 803433..803618 (+) | 186 | WP_001187236.1 | DUF3113 family protein | - |
| OS088_RS04100 | - | 803619..803980 (+) | 362 | Protein_796 | SA1788 family PVL leukocidin-associated protein | - |
| OS088_RS04105 | - | 803980..804237 (+) | 258 | WP_031807828.1 | DUF3310 domain-containing protein | - |
| OS088_RS04110 | - | 804240..804440 (+) | 201 | WP_000235326.1 | hypothetical protein | - |
| OS088_RS04115 | - | 804449..804697 (+) | 249 | WP_075339544.1 | phi PVL orf 51-like protein | - |
| OS088_RS04120 | - | 804712..805102 (+) | 391 | Protein_800 | hypothetical protein | - |
| OS088_RS04125 | - | 805099..805293 (+) | 195 | WP_031794818.1 | hypothetical protein | - |
| OS088_RS04130 | - | 805290..805727 (+) | 438 | WP_267814776.1 | YopX family protein | - |
| OS088_RS04135 | - | 805781..806023 (+) | 243 | Protein_803 | hypothetical protein | - |
| OS088_RS04140 | - | 806001..806249 (+) | 249 | WP_001065083.1 | DUF1024 family protein | - |
| OS088_RS04145 | - | 806242..806772 (+) | 531 | WP_000185666.1 | dUTPase | - |
| OS088_RS04150 | - | 806809..807015 (+) | 207 | WP_000195812.1 | DUF1381 domain-containing protein | - |
| OS088_RS04155 | - | 807012..807215 (+) | 204 | WP_001072794.1 | hypothetical protein | - |
| OS088_RS04160 | - | 807208..807444 (+) | 237 | WP_000608278.1 | DUF7366 family protein | - |
| OS088_RS04165 | - | 807434..807823 (+) | 390 | WP_001596346.1 | hypothetical protein | - |
| OS088_RS04170 | rinB | 807820..807993 (+) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| OS088_RS04175 | - | 807994..808395 (+) | 402 | WP_000286968.1 | hypothetical protein | - |
| OS088_RS04180 | - | 808748..809242 (+) | 495 | WP_000594087.1 | terminase small subunit | - |
| OS088_RS04185 | - | 809235..810458 (+) | 1224 | WP_001037578.1 | PBSX family phage terminase large subunit | - |
| OS088_RS04190 | - | 810455..811879 (+) | 1425 | WP_000177422.1 | phage portal protein | - |
| OS088_RS04195 | - | 811848..812801 (+) | 954 | WP_117206960.1 | phage head morphogenesis protein | - |
| OS088_RS04200 | - | 812803..813009 (+) | 207 | WP_000346033.1 | hypothetical protein | - |
| OS088_RS04205 | - | 813112..813696 (+) | 585 | WP_001019219.1 | DUF4355 domain-containing protein | - |
| OS088_RS04210 | - | 813713..814627 (+) | 915 | WP_267814787.1 | phage major capsid protein | - |
| OS088_RS04215 | - | 814639..814782 (+) | 144 | WP_000002931.1 | hypothetical protein | - |
| OS088_RS04220 | - | 814788..815138 (+) | 351 | WP_000177351.1 | phage head-tail adapter protein | - |
| OS088_RS04225 | - | 815150..815485 (+) | 336 | WP_000483041.1 | phage head closure protein | - |
| OS088_RS04230 | - | 815472..815885 (+) | 414 | WP_001151330.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| OS088_RS04235 | - | 815898..816323 (+) | 426 | WP_000270192.1 | DUF3168 domain-containing protein | - |
| OS088_RS04240 | - | 816324..816881 (+) | 558 | WP_000057582.1 | tail protein | - |
| OS088_RS04245 | - | 816948..817454 (+) | 507 | WP_000134337.1 | tail assembly chaperone | - |
| OS088_RS04250 | - | 817499..817783 (+) | 285 | WP_000880587.1 | hypothetical protein | - |
| OS088_RS04255 | - | 818093..820930 (+) | 2838 | WP_418896044.1 | phage tail protein | - |
| OS088_RS04260 | - | 820945..821886 (+) | 942 | WP_267814793.1 | phage tail domain-containing protein | - |
| OS088_RS04265 | - | 821897..823783 (+) | 1887 | WP_001122001.1 | SGNH/GDSL hydrolase family protein | - |
| OS088_RS04270 | - | 823796..825694 (+) | 1899 | WP_117434812.1 | hypothetical protein | - |
| OS088_RS04275 | - | 825694..827517 (+) | 1824 | WP_029052110.1 | phage baseplate upper protein | - |
| OS088_RS04280 | - | 827517..827894 (+) | 378 | WP_000705921.1 | DUF2977 domain-containing protein | - |
| OS088_RS04285 | - | 827898..828071 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| OS088_RS04290 | - | 828112..828411 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| OS088_RS04295 | - | 828548..830423 (+) | 1876 | Protein_835 | glucosaminidase domain-containing protein | - |
| OS088_RS04300 | - | 830436..831608 (+) | 1173 | WP_000276639.1 | BppU family phage baseplate upper protein | - |
| OS088_RS04305 | - | 831614..832009 (+) | 396 | WP_000398862.1 | hypothetical protein | - |
| OS088_RS04310 | - | 832065..832367 (+) | 303 | WP_000339141.1 | phage holin | - |
| OS088_RS04315 | - | 832378..833832 (+) | 1455 | WP_000909217.1 | N-acetylmuramoyl-L-alanine amidase | - |
| OS088_RS04320 | - | 834590..834796 (+) | 207 | WP_000125168.1 | hypothetical protein | - |
| OS088_RS04325 | - | 834810..835010 (+) | 201 | WP_000498229.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16047.61 Da Isoelectric Point: 5.8724
>NTDB_id=759573 OS088_RS04055 WP_000934783.1 798930..799358(+) (ssbA) [Staphylococcus aureus strain Viktor]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAIIDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAIIDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=759573 OS088_RS04055 WP_000934783.1 798930..799358(+) (ssbA) [Staphylococcus aureus strain Viktor]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTATTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTATTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.657 |
100 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
46.957 |
80.986 |
0.38 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.763 |
83.099 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.763 |
83.099 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.915 |
83.099 |
0.373 |