NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	OS089_RS01765	Genome accession	NZ_CP113049
Coordinates	340033..340344 (+)	Length	103 a.a.
NCBI ID	WP_000472256.1	Uniprot ID	-
Organism	Staphylococcus aureus strain Ahri
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 335033..345344

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OS089_RS01735	-	335816..336019 (+)	204	WP_000087561.1	YqgQ family protein	-
OS089_RS01740	-	336016..337002 (+)	987	WP_000161315.1	ROK family glucokinase	-
OS089_RS01745	-	337002..337331 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
OS089_RS01750	-	337328..337951 (+)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
OS089_RS01755	comGA	338003..338977 (+)	975	WP_000697218.1	competence type IV pilus ATPase ComGA	Machinery gene
OS089_RS01760	comGB	338949..340019 (+)	1071	WP_000776407.1	competence type IV pilus assembly protein ComGB	Machinery gene
OS089_RS01765	comGC	340033..340344 (+)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
OS089_RS01770	comGD	340322..340768 (+)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
OS089_RS01775	comGE	340755..341054 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
OS089_RS01780	comGF	340972..341469 (+)	498	WP_001838632.1	competence type IV pilus minor pilin ComGF	Machinery gene
OS089_RS01785	-	341566..341712 (+)	147	WP_001789879.1	hypothetical protein	-
OS089_RS01790	-	341702..342226 (+)	525	WP_001015116.1	shikimate kinase	-
OS089_RS01795	gcvT	342385..343476 (+)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
OS089_RS01800	gcvPA	343496..344842 (+)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268

                                >NTDB_id=759531 OS089_RS01765 WP_000472256.1 340033..340344(+) (comGC) [Staphylococcus aureus strain Ahri]

MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI

KEAQKTCKSGETITISNGEAVAN

Nucleotide

Download Length: 312 bp

                                >NTDB_id=759531 OS089_RS01765 WP_000472256.1 340033..340344(+) (comGC) [Staphylococcus aureus strain Ahri]

ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT

AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA

ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA

AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(6-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369

Detailed information NTG0759531