Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | OS087_RS01770 | Genome accession | NZ_CP113047 |
| Coordinates | 312499..312927 (-) | Length | 142 a.a. |
| NCBI ID | WP_000934783.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain Sett | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 280229..332476 | 312499..312927 | within | 0 |
Gene organization within MGE regions
Location: 280229..332476
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS087_RS01520 | scn | 280229..280579 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| OS087_RS01525 | - | 281090..281428 (-) | 339 | Protein_266 | SH3 domain-containing protein | - |
| OS087_RS01530 | sak | 282076..282567 (-) | 492 | WP_267830481.1 | staphylokinase | - |
| OS087_RS01535 | - | 282758..283513 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| OS087_RS01540 | - | 283525..283779 (-) | 255 | WP_000611512.1 | phage holin | - |
| OS087_RS01545 | - | 283831..283938 (+) | 108 | WP_031866188.1 | hypothetical protein | - |
| OS087_RS01550 | pepG1 | 283991..284125 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| OS087_RS01555 | - | 284317..284613 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| OS087_RS01560 | - | 284671..284958 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| OS087_RS01565 | - | 285005..285157 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| OS087_RS01570 | - | 285147..288932 (-) | 3786 | WP_000582178.1 | phage tail spike protein | - |
| OS087_RS01575 | - | 288948..290432 (-) | 1485 | WP_267830482.1 | phage distal tail protein | - |
| OS087_RS13910 | - | 290429..291490 (-) | 1062 | WP_418896067.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| OS087_RS01580 | - | 291640..294974 (-) | 3335 | Protein_278 | phage tail tape measure protein | - |
| OS087_RS01585 | gpGT | 295031..295168 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| OS087_RS01590 | gpG | 295219..295569 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| OS087_RS01595 | - | 295619..295849 (-) | 231 | Protein_281 | Ig-like domain-containing protein | - |
| OS087_RS01600 | - | 295885..296529 (-) | 645 | WP_000268740.1 | major tail protein | - |
| OS087_RS01605 | - | 296530..296937 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| OS087_RS01610 | - | 296934..297338 (-) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| OS087_RS01615 | - | 297335..297697 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| OS087_RS01620 | - | 297681..297965 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| OS087_RS01625 | - | 297955..298239 (-) | 285 | WP_031807821.1 | hypothetical protein | - |
| OS087_RS01630 | - | 298259..299404 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| OS087_RS01635 | - | 299428..300165 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| OS087_RS01640 | - | 300149..301336 (-) | 1188 | WP_267830483.1 | phage portal protein | - |
| OS087_RS01645 | - | 301352..303013 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| OS087_RS01650 | - | 303010..303354 (-) | 345 | WP_267811084.1 | hypothetical protein | - |
| OS087_RS01655 | - | 303485..303784 (-) | 300 | WP_000988330.1 | HNH endonuclease | - |
| OS087_RS01660 | - | 304016..304432 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| OS087_RS01665 | - | 304460..304660 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| OS087_RS01670 | rinB | 304660..304809 (-) | 150 | WP_000237868.1 | transcriptional activator RinB | - |
| OS087_RS01675 | - | 304812..305012 (-) | 201 | WP_000039541.1 | hypothetical protein | - |
| OS087_RS01680 | - | 304987..305175 (-) | 189 | WP_000195795.1 | DUF1381 domain-containing protein | - |
| OS087_RS01685 | - | 305172..305417 (-) | 246 | WP_001282070.1 | hypothetical protein | - |
| OS087_RS01690 | - | 305454..305963 (-) | 510 | WP_031911468.1 | dUTP diphosphatase | - |
| OS087_RS01695 | - | 305956..306204 (-) | 249 | WP_064266706.1 | DUF1024 family protein | - |
| OS087_RS01700 | - | 306197..306472 (-) | 276 | WP_015978314.1 | hypothetical protein | - |
| OS087_RS01705 | - | 306472..306876 (-) | 405 | WP_000694059.1 | hypothetical protein | - |
| OS087_RS01710 | - | 306890..307141 (-) | 252 | Protein_304 | SAV1978 family virulence-associated passenger protein | - |
| OS087_RS01715 | - | 307150..307351 (-) | 202 | Protein_305 | hypothetical protein | - |
| OS087_RS01720 | - | 307354..307611 (-) | 258 | WP_000111490.1 | DUF3310 domain-containing protein | - |
| OS087_RS01725 | - | 307608..308228 (-) | 621 | WP_267830484.1 | SA1788 family PVL leukocidin-associated protein | - |
| OS087_RS01730 | - | 308229..308414 (-) | 186 | WP_001187240.1 | DUF3113 family protein | - |
| OS087_RS01735 | - | 308419..308823 (-) | 405 | WP_000049784.1 | DUF1064 domain-containing protein | - |
| OS087_RS01740 | - | 308834..309055 (-) | 222 | WP_001123673.1 | DUF3269 family protein | - |
| OS087_RS01745 | - | 309068..309229 (-) | 162 | WP_000237153.1 | hypothetical protein | - |
| OS087_RS01750 | - | 309223..310002 (-) | 780 | WP_000803065.1 | ATP-binding protein | - |
| OS087_RS01755 | - | 310013..310783 (-) | 771 | WP_000190224.1 | conserved phage C-terminal domain-containing protein | - |
| OS087_RS01760 | - | 310848..311705 (+) | 858 | WP_000371250.1 | DUF4393 domain-containing protein | - |
| OS087_RS01765 | - | 311811..312485 (-) | 675 | WP_015977703.1 | putative HNHc nuclease | - |
| OS087_RS01770 | ssbA | 312499..312927 (-) | 429 | WP_000934783.1 | single-stranded DNA-binding protein | Machinery gene |
| OS087_RS01775 | - | 312927..313565 (-) | 639 | WP_001043071.1 | ERF family protein | - |
| OS087_RS01780 | - | 313565..314044 (-) | 480 | WP_000002516.1 | siphovirus Gp157 family protein | - |
| OS087_RS01785 | - | 314059..314319 (-) | 261 | WP_031807830.1 | DUF1108 family protein | - |
| OS087_RS01790 | - | 314411..314572 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| OS087_RS01795 | - | 314569..314889 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| OS087_RS01800 | - | 314948..315580 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| OS087_RS01805 | - | 315595..315735 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| OS087_RS01810 | - | 315766..315964 (-) | 199 | Protein_324 | hypothetical protein | - |
| OS087_RS01815 | - | 315977..316774 (-) | 798 | WP_267830486.1 | phage antirepressor | - |
| OS087_RS01820 | - | 316790..317059 (-) | 270 | WP_267830487.1 | helix-turn-helix transcriptional regulator | - |
| OS087_RS01825 | - | 317056..317230 (-) | 175 | Protein_327 | transcriptional regulator | - |
| OS087_RS01830 | - | 317193..317906 (+) | 714 | WP_031768797.1 | XRE family transcriptional regulator | - |
| OS087_RS01835 | - | 317918..318064 (+) | 147 | WP_001049401.1 | hypothetical protein | - |
| OS087_RS01840 | - | 318061..318246 (+) | 186 | WP_000109193.1 | hypothetical protein | - |
| OS087_RS01845 | - | 318302..318886 (+) | 585 | WP_031901045.1 | hypothetical protein | - |
| OS087_RS01850 | - | 319116..319298 (+) | 183 | WP_000694772.1 | hypothetical protein | - |
| OS087_RS01855 | - | 319398..320381 (+) | 984 | WP_031901044.1 | glycosyltransferase family 2 protein | - |
| OS087_RS01860 | - | 320392..320634 (+) | 243 | WP_031901043.1 | hypothetical protein | - |
| OS087_RS01865 | - | 320697..321734 (+) | 1038 | WP_000857185.1 | tyrosine-type recombinase/integrase | - |
| OS087_RS01870 | sph | 321791..322615 (+) | 825 | Protein_336 | sphingomyelin phosphodiesterase | - |
| OS087_RS01875 | lukG | 322853..323869 (-) | 1017 | WP_000595393.1 | bi-component leukocidin LukGH subunit G | - |
| OS087_RS01880 | lukH | 323891..324946 (-) | 1056 | WP_267830488.1 | bi-component leukocidin LukGH subunit H | - |
| OS087_RS01885 | - | 325382..326605 (+) | 1224 | WP_267830489.1 | ArgE/DapE family deacylase | - |
| OS087_RS01890 | - | 327328..327771 (-) | 444 | WP_000361985.1 | hypothetical protein | - |
| OS087_RS01895 | - | 328659..329966 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| OS087_RS01900 | groL | 330500..332116 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| OS087_RS01905 | groES | 332192..332476 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16047.61 Da Isoelectric Point: 5.8724
>NTDB_id=759484 OS087_RS01770 WP_000934783.1 312499..312927(-) (ssbA) [Staphylococcus aureus strain Sett]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAIIDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAIIDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=759484 OS087_RS01770 WP_000934783.1 312499..312927(-) (ssbA) [Staphylococcus aureus strain Sett]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTATTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTATTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.657 |
100 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
46.957 |
80.986 |
0.38 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.763 |
83.099 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.763 |
83.099 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.915 |
83.099 |
0.373 |