Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | OF158_RS08910 | Genome accession | NZ_CP109616 |
| Coordinates | 1900276..1900668 (-) | Length | 130 a.a. |
| NCBI ID | WP_302469430.1 | Uniprot ID | - |
| Organism | Weizmannia sp. WK01 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1872725..1919654 | 1900276..1900668 | within | 0 |
Gene organization within MGE regions
Location: 1872725..1919654
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF158_RS08715 (OF158_08715) | - | 1872725..1872958 (-) | 234 | WP_014098216.1 | DUF896 domain-containing protein | - |
| OF158_RS08720 (OF158_08720) | - | 1873049..1873702 (-) | 654 | WP_014098215.1 | recombinase family protein | - |
| OF158_RS08725 (OF158_08725) | - | 1873699..1874037 (-) | 339 | WP_014098214.1 | LysM peptidoglycan-binding domain-containing protein | - |
| OF158_RS08730 (OF158_08730) | lexA | 1874244..1874864 (+) | 621 | WP_014098213.1 | transcriptional repressor LexA | - |
| OF158_RS08735 (OF158_08735) | - | 1875314..1876030 (+) | 717 | WP_035184796.1 | hypothetical protein | - |
| OF158_RS08740 (OF158_08740) | - | 1876135..1876974 (-) | 840 | WP_052042174.1 | N-acetylmuramoyl-L-alanine amidase | - |
| OF158_RS08745 (OF158_08745) | - | 1877029..1877268 (-) | 240 | WP_172653413.1 | phage holin | - |
| OF158_RS08750 (OF158_08750) | - | 1877280..1877555 (-) | 276 | WP_052042172.1 | hemolysin XhlA family protein | - |
| OF158_RS08755 (OF158_08755) | - | 1877671..1877925 (-) | 255 | WP_035184794.1 | hypothetical protein | - |
| OF158_RS08760 (OF158_08760) | - | 1877996..1878163 (-) | 168 | WP_164931350.1 | hypothetical protein | - |
| OF158_RS08765 (OF158_08765) | - | 1878166..1878456 (-) | 291 | WP_035184791.1 | hypothetical protein | - |
| OF158_RS08770 (OF158_08770) | - | 1878472..1879200 (-) | 729 | WP_035184789.1 | hypothetical protein | - |
| OF158_RS08775 (OF158_08775) | - | 1879210..1880679 (-) | 1470 | WP_052042170.1 | metallophosphoesterase | - |
| OF158_RS08780 (OF158_08780) | - | 1880679..1882085 (-) | 1407 | WP_052042168.1 | phage tail protein | - |
| OF158_RS08785 (OF158_08785) | - | 1882094..1882918 (-) | 825 | WP_035184787.1 | phage tail domain-containing protein | - |
| OF158_RS08790 (OF158_08790) | - | 1882926..1887104 (-) | 4179 | WP_052498231.1 | phage tail tape measure protein | - |
| OF158_RS08795 (OF158_08795) | - | 1887273..1887599 (-) | 327 | WP_035184785.1 | hypothetical protein | - |
| OF158_RS08800 (OF158_08800) | - | 1887653..1888261 (-) | 609 | WP_035184783.1 | major tail protein | - |
| OF158_RS08805 (OF158_08805) | - | 1888274..1888660 (-) | 387 | WP_035184781.1 | hypothetical protein | - |
| OF158_RS08810 (OF158_08810) | - | 1888657..1889088 (-) | 432 | WP_035184779.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| OF158_RS08815 (OF158_08815) | - | 1889088..1889420 (-) | 333 | WP_035184777.1 | phage head closure protein | - |
| OF158_RS08820 (OF158_08820) | - | 1889423..1889707 (-) | 285 | WP_035184775.1 | head-tail connector protein | - |
| OF158_RS08825 (OF158_08825) | - | 1889721..1890869 (-) | 1149 | WP_052042165.1 | phage major capsid protein | - |
| OF158_RS08830 (OF158_08830) | - | 1890884..1891600 (-) | 717 | WP_035184773.1 | head maturation protease, ClpP-related | - |
| OF158_RS08835 (OF158_08835) | - | 1891587..1892873 (-) | 1287 | WP_035184772.1 | phage portal protein | - |
| OF158_RS08840 (OF158_08840) | - | 1892892..1894460 (-) | 1569 | WP_088775930.1 | terminase large subunit | - |
| OF158_RS08845 (OF158_08845) | - | 1894450..1894986 (-) | 537 | WP_035184770.1 | hypothetical protein | - |
| OF158_RS08850 (OF158_08850) | - | 1895094..1895465 (-) | 372 | WP_035184768.1 | HNH endonuclease | - |
| OF158_RS08855 (OF158_08855) | - | 1895471..1895689 (-) | 219 | WP_035184766.1 | hypothetical protein | - |
| OF158_RS08860 (OF158_08860) | - | 1896013..1896312 (-) | 300 | WP_035184764.1 | hypothetical protein | - |
| OF158_RS08865 (OF158_08865) | - | 1896474..1897016 (-) | 543 | WP_035184762.1 | site-specific integrase | - |
| OF158_RS08870 (OF158_08870) | - | 1897013..1897468 (-) | 456 | WP_035184760.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| OF158_RS08875 (OF158_08875) | - | 1897571..1898257 (-) | 687 | WP_035184757.1 | phage antirepressor KilAC domain-containing protein | - |
| OF158_RS08880 (OF158_08880) | - | 1898320..1898559 (-) | 240 | WP_035184755.1 | hypothetical protein | - |
| OF158_RS08885 (OF158_08885) | - | 1898577..1898777 (-) | 201 | WP_035184753.1 | hypothetical protein | - |
| OF158_RS08890 (OF158_08890) | - | 1898783..1899085 (-) | 303 | WP_035184750.1 | hypothetical protein | - |
| OF158_RS08895 (OF158_08895) | - | 1899100..1899282 (-) | 183 | WP_035184748.1 | hypothetical protein | - |
| OF158_RS08900 (OF158_08900) | - | 1899551..1899739 (-) | 189 | WP_035184746.1 | BH0509 family protein | - |
| OF158_RS08905 (OF158_08905) | - | 1899872..1900081 (-) | 210 | WP_035184744.1 | XtrA/YqaO family protein | - |
| OF158_RS08910 (OF158_08910) | ssbA | 1900276..1900668 (-) | 393 | WP_302469430.1 | single-stranded DNA-binding protein | Machinery gene |
| OF158_RS08915 (OF158_08915) | - | 1900665..1901627 (-) | 963 | WP_035184743.1 | DnaD domain-containing protein | - |
| OF158_RS08920 (OF158_08920) | - | 1901640..1902005 (-) | 366 | WP_035184742.1 | hypothetical protein | - |
| OF158_RS08925 (OF158_08925) | - | 1902169..1902360 (-) | 192 | WP_035184741.1 | hypothetical protein | - |
| OF158_RS08930 (OF158_08930) | - | 1902447..1902728 (-) | 282 | WP_043052499.1 | YqaH family protein | - |
| OF158_RS08935 (OF158_08935) | - | 1902741..1903010 (-) | 270 | WP_035184739.1 | group-specific protein | - |
| OF158_RS08940 (OF158_08940) | - | 1903035..1903556 (-) | 522 | WP_035184735.1 | helix-turn-helix domain-containing protein | - |
| OF158_RS08945 (OF158_08945) | - | 1903845..1904072 (-) | 228 | WP_035184732.1 | helix-turn-helix domain-containing protein | - |
| OF158_RS08950 (OF158_08950) | - | 1904218..1904637 (+) | 420 | WP_035184731.1 | helix-turn-helix domain-containing protein | - |
| OF158_RS08955 (OF158_08955) | - | 1904766..1905683 (+) | 918 | WP_035184729.1 | BRCT domain-containing protein | - |
| OF158_RS08960 (OF158_08960) | - | 1905713..1906675 (+) | 963 | WP_052042163.1 | exonuclease domain-containing protein | - |
| OF158_RS08965 (OF158_08965) | - | 1906721..1908721 (+) | 2001 | WP_035184727.1 | DEAD/DEAH box helicase | - |
| OF158_RS08970 (OF158_08970) | - | 1908725..1908991 (+) | 267 | WP_035184725.1 | hypothetical protein | - |
| OF158_RS08975 (OF158_08975) | - | 1909087..1909605 (+) | 519 | WP_337680427.1 | ImmA/IrrE family metallo-endopeptidase | - |
| OF158_RS08980 (OF158_08980) | - | 1909648..1910781 (+) | 1134 | WP_264302922.1 | site-specific integrase | - |
| OF158_RS08985 (OF158_08985) | glnA | 1910890..1912227 (-) | 1338 | WP_014098212.1 | type I glutamate--ammonia ligase | - |
| OF158_RS08990 (OF158_08990) | - | 1912297..1912686 (-) | 390 | WP_014098211.1 | MerR family transcriptional regulator | - |
| OF158_RS08995 (OF158_08995) | - | 1912779..1916378 (-) | 3600 | WP_017550446.1 | dynamin family protein | - |
| OF158_RS09000 (OF158_09000) | - | 1916544..1916747 (+) | 204 | WP_014098209.1 | hypothetical protein | - |
| OF158_RS09005 (OF158_09005) | - | 1916872..1917710 (+) | 839 | Protein_1765 | SPFH domain-containing protein | - |
| OF158_RS09010 (OF158_09010) | - | 1917757..1919070 (-) | 1314 | WP_014098207.1 | nucleobase:cation symporter-2 family protein | - |
| OF158_RS09015 (OF158_09015) | - | 1919067..1919654 (-) | 588 | WP_014098206.1 | xanthine phosphoribosyltransferase | - |
Sequence
Protein
Download Length: 130 a.a. Molecular weight: 14402.33 Da Isoelectric Point: 7.9971
>NTDB_id=748567 OF158_RS08910 WP_302469430.1 1900276..1900668(-) (ssbA) [Weizmannia sp. WK01]
MINPVVLTGRLTADPVLRYTPSGVAVTTFTLAVNRTFSVQSGKKEADFVSVIAWRKIAENIANYLSKGNLIGVDGRLQTR
SYEDNNGKRVFVTEVVSEHVCFLETKKNRLANEPQGSQDLPPFSDDNLPF
MINPVVLTGRLTADPVLRYTPSGVAVTTFTLAVNRTFSVQSGKKEADFVSVIAWRKIAENIANYLSKGNLIGVDGRLQTR
SYEDNNGKRVFVTEVVSEHVCFLETKKNRLANEPQGSQDLPPFSDDNLPF
Nucleotide
Download Length: 393 bp
>NTDB_id=748567 OF158_RS08910 WP_302469430.1 1900276..1900668(-) (ssbA) [Weizmannia sp. WK01]
ATGATAAATCCTGTGGTTTTAACCGGTAGGCTGACTGCAGATCCGGTCTTGCGTTATACACCAAGCGGCGTTGCTGTTAC
GACATTTACGCTTGCGGTGAACCGAACATTTTCCGTCCAGAGTGGCAAAAAGGAAGCGGACTTTGTCAGCGTGATTGCCT
GGCGGAAGATAGCTGAGAATATCGCAAATTATTTATCAAAAGGCAACCTGATCGGCGTGGACGGACGGCTGCAGACACGC
AGTTATGAAGACAATAATGGCAAGCGGGTATTCGTTACGGAAGTGGTCTCAGAACATGTGTGTTTTCTCGAAACAAAGAA
AAATAGGCTTGCAAATGAACCACAAGGAAGTCAGGATCTGCCGCCGTTTAGCGACGACAATTTGCCGTTTTAA
ATGATAAATCCTGTGGTTTTAACCGGTAGGCTGACTGCAGATCCGGTCTTGCGTTATACACCAAGCGGCGTTGCTGTTAC
GACATTTACGCTTGCGGTGAACCGAACATTTTCCGTCCAGAGTGGCAAAAAGGAAGCGGACTTTGTCAGCGTGATTGCCT
GGCGGAAGATAGCTGAGAATATCGCAAATTATTTATCAAAAGGCAACCTGATCGGCGTGGACGGACGGCTGCAGACACGC
AGTTATGAAGACAATAATGGCAAGCGGGTATTCGTTACGGAAGTGGTCTCAGAACATGTGTGTTTTCTCGAAACAAAGAA
AAATAGGCTTGCAAATGAACCACAAGGAAGTCAGGATCTGCCGCCGTTTAGCGACGACAATTTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
67.925 |
81.538 |
0.554 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
59.434 |
81.538 |
0.485 |
| ssbA | Streptococcus mutans UA159 |
46.212 |
100 |
0.469 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
81.538 |
0.462 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.182 |
100 |
0.438 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.424 |
100 |
0.431 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.424 |
100 |
0.431 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.667 |
100 |
0.423 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.667 |
100 |
0.423 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.667 |
100 |
0.423 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.667 |
100 |
0.423 |