Detailed information NTG0735314

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LLUC7005_RS10765
• Genome accession: NZ_CP120933
• Coordinates: 2147133..2147402 (-)
• Length: 89 a.a.
• NCBI ID: WP_003129998.1
• Uniprot ID: -
• Organism: Lactococcus lactis subsp. lactis strain UC7005
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2142133..2152402

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLUC7005_RS10725 (LLUC7005_10695)	-	2142660..2143469 (-)	810	WP_014570791.1	metal ABC transporter permease	-
LLUC7005_RS10730 (LLUC7005_10700)	-	2143462..2144199 (-)	738	WP_003129989.1	metal ABC transporter ATP-binding protein	-
LLUC7005_RS10735 (LLUC7005_10705)	-	2144376..2145218 (-)	843	WP_003129990.1	metal ABC transporter substrate-binding protein	-
LLUC7005_RS10740 (LLUC7005_10710)	-	2145215..2145652 (-)	438	WP_003129992.1	zinc-dependent MarR family transcriptional regulator	-
LLUC7005_RS10745 (LLUC7005_10715)	comGG	2145742..2146026 (-)	285	WP_003129993.1	competence type IV pilus minor pilin ComGG	Machinery gene
LLUC7005_RS10750 (LLUC7005_10720)	comGF	2146065..2146511 (-)	447	WP_029344525.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLUC7005_RS10755 (LLUC7005_10725)	comGE	2146474..2146770 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLUC7005_RS10760 (LLUC7005_10730)	comGD	2146742..2147173 (-)	432	WP_014570794.1	competence type IV pilus minor pilin ComGD	Machinery gene
LLUC7005_RS10765 (LLUC7005_10735)	comGC	2147133..2147402 (-)	270	WP_003129998.1	competence type IV pilus major pilin ComGC	Machinery gene
LLUC7005_RS10770 (LLUC7005_10740)	-	2147549..2148073 (-)	525	WP_014570795.1	GNAT family N-acetyltransferase	-
LLUC7005_RS10775 (LLUC7005_10745)	-	2148152..2148931 (-)	780	WP_014570796.1	peptidoglycan amidohydrolase family protein	-
LLUC7005_RS10780 (LLUC7005_10750)	-	2148931..2149230 (-)	300	WP_014570797.1	phage holin	-
LLUC7005_RS10785 (LLUC7005_10755)	-	2149243..2149593 (-)	351	WP_014570798.1	hypothetical protein	-
LLUC7005_RS10790 (LLUC7005_10760)	-	2149606..2149842 (-)	237	WP_014570799.1	hypothetical protein	-

Sequence

Protein

• Length: 89 a.a.
• Molecular weight: 10123.56 Da
• Isoelectric Point: 4.2950

>NTDB_id=735314 LLUC7005_RS10765 WP_003129998.1 2147133..2147402(-) (comGC) [Lactococcus lactis subsp. lactis strain UC7005]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND

Nucleotide

• Length: 270 bp

>NTDB_id=735314 LLUC7005_RS10765 WP_003129998.1 2147133..2147402(-) (comGC) [Lactococcus lactis subsp. lactis strain UC7005]
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	86.667	84.27	0.73
comGC/cglC	Streptococcus pneumoniae Rx1	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae D39	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae R6	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae TIGR4	55.056	100	0.551
comGC	Streptococcus gordonii str. Challis substr. CH1	56.471	95.506	0.539
comGC	Streptococcus suis isolate S10	58.904	82.022	0.483
comGC/cglC	Streptococcus mitis SK321	53.947	85.393	0.461
comGC	Streptococcus mutans UA140	50.685	82.022	0.416
comGC	Streptococcus mutans UA159	50.685	82.022	0.416
comGC/cglC	Streptococcus mitis NCTC 12261	56.25	71.91	0.404