Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LLUC7005_RS10745 Genome accession   NZ_CP120933
Coordinates   2145742..2146026 (-) Length   94 a.a.
NCBI ID   WP_003129993.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain UC7005     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2140742..2151026
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLUC7005_RS10715 (LLUC7005_10685) - 2141174..2141551 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  LLUC7005_RS10720 (LLUC7005_10690) - 2141755..2142621 (+) 867 WP_003129984.1 RluA family pseudouridine synthase -
  LLUC7005_RS10725 (LLUC7005_10695) - 2142660..2143469 (-) 810 WP_014570791.1 metal ABC transporter permease -
  LLUC7005_RS10730 (LLUC7005_10700) - 2143462..2144199 (-) 738 WP_003129989.1 metal ABC transporter ATP-binding protein -
  LLUC7005_RS10735 (LLUC7005_10705) - 2144376..2145218 (-) 843 WP_003129990.1 metal ABC transporter substrate-binding protein -
  LLUC7005_RS10740 (LLUC7005_10710) - 2145215..2145652 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  LLUC7005_RS10745 (LLUC7005_10715) comGG 2145742..2146026 (-) 285 WP_003129993.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLUC7005_RS10750 (LLUC7005_10720) comGF 2146065..2146511 (-) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLUC7005_RS10755 (LLUC7005_10725) comGE 2146474..2146770 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLUC7005_RS10760 (LLUC7005_10730) comGD 2146742..2147173 (-) 432 WP_014570794.1 competence type IV pilus minor pilin ComGD Machinery gene
  LLUC7005_RS10765 (LLUC7005_10735) comGC 2147133..2147402 (-) 270 WP_003129998.1 competence type IV pilus major pilin ComGC Machinery gene
  LLUC7005_RS10770 (LLUC7005_10740) - 2147549..2148073 (-) 525 WP_014570795.1 GNAT family N-acetyltransferase -
  LLUC7005_RS10775 (LLUC7005_10745) - 2148152..2148931 (-) 780 WP_014570796.1 peptidoglycan amidohydrolase family protein -
  LLUC7005_RS10780 (LLUC7005_10750) - 2148931..2149230 (-) 300 WP_014570797.1 phage holin -
  LLUC7005_RS10785 (LLUC7005_10755) - 2149243..2149593 (-) 351 WP_014570798.1 hypothetical protein -
  LLUC7005_RS10790 (LLUC7005_10760) - 2149606..2149842 (-) 237 WP_014570799.1 hypothetical protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=735310 LLUC7005_RS10745 WP_003129993.1 2145742..2146026(-) (comGG) [Lactococcus lactis subsp. lactis strain UC7005]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=735310 LLUC7005_RS10745 WP_003129993.1 2145742..2146026(-) (comGG) [Lactococcus lactis subsp. lactis strain UC7005]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585