Detailed information NTG0715223

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: M0P28_RS00795
• Genome accession: NZ_CP116958
• Coordinates: 119584..120015 (+)
• Length: 143 a.a.
• NCBI ID: WP_058692630.1
• Uniprot ID: -
• Organism: Streptococcus pasteurianus strain WUSP074
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 114584..125015

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
M0P28_RS00775 (M0P28_00775)	-	116966..117328 (+)	363	WP_058692629.1	DUF1033 family protein	-
M0P28_RS00780 (M0P28_00780)	comGA	117399..118340 (+)	942	WP_003062917.1	competence type IV pilus ATPase ComGA	Machinery gene
M0P28_RS00785 (M0P28_00785)	comGB	118264..119307 (+)	1044	WP_003062919.1	competence type IV pilus assembly protein ComGB	Machinery gene
M0P28_RS00790 (M0P28_00790)	comGC	119307..119600 (+)	294	WP_117479472.1	competence type IV pilus major pilin ComGC	Machinery gene
M0P28_RS00795 (M0P28_00795)	comGD	119584..120015 (+)	432	WP_058692630.1	competence type IV pilus minor pilin ComGD	Machinery gene
M0P28_RS00800 (M0P28_00800)	comGE	119969..120262 (+)	294	WP_081048608.1	competence type IV pilus minor pilin ComGE	Machinery gene
M0P28_RS00805 (M0P28_00805)	comGF	120216..120683 (+)	468	WP_058692632.1	competence type IV pilus minor pilin ComGF	Machinery gene
M0P28_RS00810 (M0P28_00810)	comGG	120637..120987 (+)	351	WP_238374707.1	competence type IV pilus minor pilin ComGG	Machinery gene
M0P28_RS00815 (M0P28_00815)	comGH	121042..122013 (+)	972	WP_117479470.1	class I SAM-dependent methyltransferase	Machinery gene
M0P28_RS00820 (M0P28_00820)	-	122051..123250 (+)	1200	WP_058692635.1	acetate kinase	-
M0P28_RS00825 (M0P28_00825)	-	123417..123617 (+)	201	WP_058692636.1	helix-turn-helix transcriptional regulator	-
M0P28_RS00830 (M0P28_00830)	-	123627..123833 (+)	207	WP_058692637.1	hypothetical protein	-
M0P28_RS00835 (M0P28_00835)	-	123824..124276 (+)	453	WP_117479468.1	ABC transporter permease	-
M0P28_RS00840 (M0P28_00840)	-	124288..124923 (+)	636	WP_058692639.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

• Length: 143 a.a.
• Molecular weight: 16001.39 Da
• Isoelectric Point: 8.9601

>NTDB_id=715223 M0P28_RS00795 WP_058692630.1 119584..120015(+) (comGD) [Streptococcus pasteurianus strain WUSP074]
MKLKNKTVSAFTLLESLLTLGISCFIIMMLSGSLNGIFQNVEEKIFFLSFENLYCDTQKLANARQQSLTLTVSQEEVSTD
FSAVKLPPSVKVDKTYQVNFDKAGGNSSLAKLTFQTSDKEFNYQLYLGSGKYKKTETKSLHTP

Nucleotide

• Length: 432 bp

>NTDB_id=715223 M0P28_RS00795 WP_058692630.1 119584..120015(+) (comGD) [Streptococcus pasteurianus strain WUSP074]
ATGAAGCTAAAAAATAAAACAGTTTCAGCTTTTACCCTTTTAGAAAGTTTATTAACACTAGGAATTTCCTGTTTTATTAT
CATGATGTTGTCAGGCTCTTTGAATGGCATTTTTCAAAATGTGGAAGAAAAGATTTTCTTTTTATCGTTTGAAAATCTCT
ATTGTGACACGCAAAAATTAGCTAATGCTAGGCAACAAAGTCTTACGTTGACTGTTTCGCAAGAGGAAGTATCTACTGAT
TTCTCAGCGGTAAAACTCCCTCCATCGGTCAAAGTTGATAAAACTTATCAAGTCAATTTTGACAAAGCAGGAGGCAATTC
GTCCTTGGCAAAATTAACCTTTCAAACGTCAGATAAAGAGTTCAACTATCAATTATATTTAGGGAGTGGTAAATATAAAA
AGACAGAAACTAAAAGCTTACATACTCCTTGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Streptococcus mutans UA140	53.435	91.608	0.49
comGD	Streptococcus mutans UA159	53.435	91.608	0.49
comGD/cglD	Streptococcus pneumoniae D39	46.212	92.308	0.427
comGD/cglD	Streptococcus pneumoniae Rx1	46.212	92.308	0.427
comGD/cglD	Streptococcus mitis NCTC 12261	46.212	92.308	0.427
comGD/cglD	Streptococcus pneumoniae TIGR4	46.212	92.308	0.427
comGD/cglD	Streptococcus pneumoniae R6	46.212	92.308	0.427
comGD	Streptococcus gordonii str. Challis substr. CH1	45.185	94.406	0.427
comGD/cglD	Streptococcus mitis SK321	45.455	92.308	0.42