Detailed information NTG0713681

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: NPS16_RS09045
• Genome accession: NZ_CP101986
• Coordinates: 1902316..1902630 (-)
• Length: 104 a.a.
• NCBI ID: WP_002263437.1
• Uniprot ID: -
• Organism: Streptococcus mutans strain COCC33-14
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1897316..1907630

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NPS16_RS09005 (NPS16_09005)	-	1897399..1897839 (-)	441	WP_002263445.1	hypothetical protein	-
NPS16_RS09010 (NPS16_09010)	-	1897808..1898053 (-)	246	WP_002263444.1	helix-turn-helix transcriptional regulator	-
NPS16_RS09015 (NPS16_09015)	-	1898606..1899805 (-)	1200	WP_002265895.1	acetate kinase	-
NPS16_RS09020 (NPS16_09020)	comYH	1899864..1900817 (-)	954	WP_019317550.1	class I SAM-dependent methyltransferase	Machinery gene
NPS16_RS09025 (NPS16_09025)	comYG	1900872..1901261 (-)	390	WP_002263441.1	competence type IV pilus minor pilin ComGG	Machinery gene
NPS16_RS09030 (NPS16_09030)	comYF	1901239..1901673 (-)	435	WP_002263440.1	competence type IV pilus minor pilin ComGF	Machinery gene
NPS16_RS09035 (NPS16_09035)	comYE	1901660..1901953 (-)	294	WP_258968995.1	competence type IV pilus minor pilin ComGE	Machinery gene
NPS16_RS09040 (NPS16_09040)	comYD	1901925..1902329 (-)	405	WP_168742475.1	competence type IV pilus minor pilin ComGD	Machinery gene
NPS16_RS09045 (NPS16_09045)	comYC	1902316..1902630 (-)	315	WP_002263437.1	competence type IV pilus major pilin ComGC	Machinery gene
NPS16_RS09050 (NPS16_09050)	comYB	1902630..1903661 (-)	1032	WP_258969313.1	competence type IV pilus assembly protein ComGB	Machinery gene
NPS16_RS09055 (NPS16_09055)	comYA	1903597..1904538 (-)	942	WP_002263435.1	competence type IV pilus ATPase ComGA	Machinery gene
NPS16_RS09060 (NPS16_09060)	-	1904669..1905052 (-)	384	WP_002263434.1	DUF1033 family protein	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11591.60 Da
• Isoelectric Point: 10.2206

>NTDB_id=713681 NPS16_RS09045 WP_002263437.1 1902316..1902630(-) (comYC) [Streptococcus mutans strain COCC33-14]
MKKIKRVSVRAFTLIEMLVVLLIISILLLLFVPNLTKQKDKVKDTGGSAVVKVVESQAELYELNKTDSATLSKLVASGDI
TQEQANSYKDYYAKHPSKTRHVAN

Nucleotide

• Length: 315 bp

>NTDB_id=713681 NPS16_RS09045 WP_002263437.1 1902316..1902630(-) (comYC) [Streptococcus mutans strain COCC33-14]
ATGAAAAAGATCAAGAGAGTCAGTGTACGGGCTTTTACGCTTATAGAAATGTTAGTAGTTCTTCTCATTATTAGTATTCT
TTTACTATTATTTGTTCCTAATTTAACTAAGCAAAAAGATAAGGTAAAAGATACTGGCGGTTCTGCCGTGGTTAAAGTTG
TAGAAAGTCAGGCTGAGCTTTATGAGCTTAATAAAACCGATTCTGCTACTCTTTCTAAATTAGTAGCTAGTGGTGATATT
ACACAAGAACAGGCAAATTCATACAAGGATTACTATGCAAAACACCCAAGTAAAACACGGCATGTCGCGAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	100	100	1
comYC	Streptococcus mutans UA159	100	100	1
comYC	Streptococcus gordonii str. Challis substr. CH1	71.429	100	0.721
comGC/cglC	Streptococcus mitis SK321	66.667	95.192	0.635
comGC/cglC	Streptococcus mitis NCTC 12261	69.565	88.462	0.615
comGC/cglC	Streptococcus pneumoniae R6	63.636	95.192	0.606
comGC/cglC	Streptococcus pneumoniae Rx1	63.636	95.192	0.606
comGC/cglC	Streptococcus pneumoniae D39	63.636	95.192	0.606
comGC/cglC	Streptococcus pneumoniae TIGR4	63.636	95.192	0.606
comGC	Lactococcus lactis subsp. cremoris KW2	55.446	97.115	0.538
comYC	Streptococcus suis isolate S10	60.227	84.615	0.51