Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | LPT20_RS13755 | Genome accession | NZ_CP099504 |
| Coordinates | 2797504..2797815 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain S36 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2792504..2802815
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT20_RS13725 (LPT20_13725) | - | 2793287..2793490 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| LPT20_RS13730 (LPT20_13730) | - | 2793487..2794473 (+) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| LPT20_RS13735 (LPT20_13735) | - | 2794473..2794802 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| LPT20_RS13740 (LPT20_13740) | - | 2794799..2795422 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| LPT20_RS13745 (LPT20_13745) | comGA | 2795474..2796448 (+) | 975 | WP_000697218.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| LPT20_RS13750 (LPT20_13750) | comGB | 2796420..2797490 (+) | 1071 | WP_000776407.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LPT20_RS13755 (LPT20_13755) | comGC | 2797504..2797815 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LPT20_RS13760 (LPT20_13760) | comGD | 2797793..2798239 (+) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LPT20_RS13765 (LPT20_13765) | comGE | 2798226..2798525 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| LPT20_RS13770 (LPT20_13770) | comGF | 2798443..2798940 (+) | 498 | WP_001838632.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LPT20_RS13775 (LPT20_13775) | - | 2799037..2799183 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| LPT20_RS13780 (LPT20_13780) | - | 2799173..2799697 (+) | 525 | WP_001015116.1 | shikimate kinase | - |
| LPT20_RS13785 (LPT20_13785) | gcvT | 2799856..2800947 (+) | 1092 | WP_229360032.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| LPT20_RS13790 (LPT20_13790) | gcvPA | 2800967..2802313 (+) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=700212 LPT20_RS13755 WP_000472256.1 2797504..2797815(+) (comGC) [Staphylococcus aureus strain S36]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=700212 LPT20_RS13755 WP_000472256.1 2797504..2797815(+) (comGC) [Staphylococcus aureus strain S36]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |