Detailed information NTG0070004

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: SA27298_RS08220
• Genome accession: NZ_AP018548
• Coordinates: 1684077..1684394 (-)
• Length: 105 a.a.
• NCBI ID: WP_003026997.1
• Uniprot ID: -
• Organism: Streptococcus anginosus strain CCUG 27928
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1679077..1689394

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SA27298_RS08190 (SA27298_1670)	-	1680412..1681611 (-)	1200	WP_003032291.1	acetate kinase	-
SA27298_RS08195 (SA27298_1671)	comYH	1681658..1682611 (-)	954	WP_003032282.1	class I SAM-dependent methyltransferase	Machinery gene
SA27298_RS08200 (SA27298_1672)	comGG	1682696..1683022 (-)	327	WP_018543596.1	competence type IV pilus minor pilin ComGG	-
SA27298_RS08205 (SA27298_1673)	comGF/cglF	1683003..1683440 (-)	438	WP_003032293.1	competence type IV pilus minor pilin ComGF	Machinery gene
SA27298_RS08210 (SA27298_1674)	comGE/cglE	1683424..1683717 (-)	294	WP_003032294.1	competence type IV pilus minor pilin ComGE	Machinery gene
SA27298_RS08215 (SA27298_1675)	comYD	1683689..1684087 (-)	399	WP_003032289.1	competence type IV pilus minor pilin ComGD	Machinery gene
SA27298_RS08220 (SA27298_1676)	comYC	1684077..1684394 (-)	318	WP_003026997.1	competence type IV pilus major pilin ComGC	Machinery gene
SA27298_RS08225 (SA27298_1677)	comYB	1684391..1685413 (-)	1023	WP_037582505.1	competence type IV pilus assembly protein ComGB	Machinery gene
SA27298_RS08230 (SA27298_1678)	comYA	1685355..1686296 (-)	942	WP_003032308.1	competence type IV pilus ATPase ComGA	Machinery gene
SA27298_RS08235 (SA27298_1679)	-	1686366..1686731 (-)	366	WP_003032307.1	DUF1033 family protein	-
SA27298_RS08240 (SA27298_1680)	glnA	1686919..1688265 (-)	1347	WP_003032299.1	type I glutamate--ammonia ligase	-
SA27298_RS08245 (SA27298_1681)	-	1688304..1688663 (-)	360	WP_003028467.1	MerR family transcriptional regulator	-
SA27298_RS08250 (SA27298_1682)	-	1688740..1689270 (-)	531	WP_003032280.1	aromatic acid exporter family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11636.74 Da
• Isoelectric Point: 10.1006

>NTDB_id=70004 SA27298_RS08220 WP_003026997.1 1684077..1684394(-) (comYC) [Streptococcus anginosus strain CCUG 27928]
MKKLKSLKVKGFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLINEGT
ITDKQAASYKAYYAKHTKEARSVAD

Nucleotide

• Length: 318 bp

>NTDB_id=70004 SA27298_RS08220 WP_003026997.1 1684077..1684394(-) (comYC) [Streptococcus anginosus strain CCUG 27928]
ATGAAAAAATTAAAAAGTTTGAAAGTTAAAGGTTTTACTTTAGTAGAAATGTTAGTCGTGCTTCTTATTATCAGTGTTTT
GATGCTCTTGTTCGTGCCGAATTTGACCAAGCAAAAAGAAGCGGTGACGGAAAAAGGAAATGCAGCGGTGGTAAAAGTTG
TGGAAAGCCAGGCAGAGCTGTTTGAGGTTAATCACACCAATGAAAAAGCGACACTCTCAAAATTAATCAACGAAGGCACG
ATTACAGACAAGCAGGCAGCATCTTATAAGGCTTACTATGCGAAACATACAAAAGAAGCTCGTTCTGTTGCAGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	72.381	100	0.724
comGC/cglC	Streptococcus mitis NCTC 12261	68.627	97.143	0.667
comGC/cglC	Streptococcus mitis SK321	68.627	97.143	0.667
comYC	Streptococcus mutans UA140	65.714	100	0.657
comYC	Streptococcus mutans UA159	65.714	100	0.657
comGC/cglC	Streptococcus pneumoniae R6	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae D39	66.667	97.143	0.648
comYC	Streptococcus suis isolate S10	66.292	84.762	0.562
comGC	Lactococcus lactis subsp. cremoris KW2	54.808	99.048	0.543