Detailed information NTG0698189

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: NF323_RS07195
• Genome accession: NZ_CP098820
• Coordinates: 1437167..1437478 (+)
• Length: 103 a.a.
• NCBI ID: WP_030063893.1
• Uniprot ID: -
• Organism: Staphylococcus capitis strain XWZ
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1432167..1442478

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NF323_RS07165 (NF323_07160)	-	1432942..1433145 (+)	204	WP_002433937.1	YqgQ family protein	-
NF323_RS07170 (NF323_07165)	-	1433142..1434128 (+)	987	WP_023350198.1	ROK family glucokinase	-
NF323_RS07175 (NF323_07170)	-	1434128..1434454 (+)	327	WP_002433945.1	MTH1187 family thiamine-binding protein	-
NF323_RS07180 (NF323_07175)	-	1434454..1435077 (+)	624	WP_023350199.1	MBL fold metallo-hydrolase	-
NF323_RS07185 (NF323_07180)	comGA	1435135..1436109 (+)	975	WP_023350200.1	competence type IV pilus ATPase ComGA	Machinery gene
NF323_RS07190 (NF323_07185)	comGB	1436081..1437148 (+)	1068	WP_023350201.1	competence type IV pilus assembly protein ComGB	-
NF323_RS07195 (NF323_07190)	comGC	1437167..1437478 (+)	312	WP_030063893.1	competence type IV pilus major pilin ComGC	Machinery gene
NF323_RS07200 (NF323_07195)	comGD	1437456..1437905 (+)	450	WP_023350202.1	competence type IV pilus minor pilin ComGD	-
NF323_RS07205 (NF323_07200)	-	1437892..1438191 (+)	300	WP_023350203.1	hypothetical protein	-
NF323_RS07210 (NF323_07205)	comGF	1438109..1438600 (+)	492	WP_037560565.1	competence type IV pilus minor pilin ComGF	-
NF323_RS07215 (NF323_07215)	-	1438770..1439279 (+)	510	WP_029625706.1	shikimate kinase	-
NF323_RS07220 (NF323_07220)	gcvT	1439488..1440579 (+)	1092	WP_023350205.1	glycine cleavage system aminomethyltransferase GcvT	-
NF323_RS07225 (NF323_07225)	gcvPA	1440598..1441944 (+)	1347	WP_023350206.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11344.49 Da
• Isoelectric Point: 10.2135

>NTDB_id=698189 NF323_RS07195 WP_030063893.1 1437167..1437478(+) (comGC) [Staphylococcus capitis strain XWZ]
MLKKLKKSKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCDAQVKMVNSQIEAYTLKHNRNPNNIEKLIAEGFI
KEGQKNCKSGQTISISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=698189 NF323_RS07195 WP_030063893.1 1437167..1437478(+) (comGC) [Staphylococcus capitis strain XWZ]
ATATTAAAAAAACTAAAAAAATCTAAAGCTTTCACTTTAATTGAAATGTTACTTGTTTTATTAATTATTAGTTTATTACT
TATTTTAATTATACCTAATATTGCCAAACAAACAGCACATATCCAATCTACTGGTTGTGATGCTCAAGTAAAAATGGTAA
ATAGTCAAATTGAAGCATATACATTAAAGCATAATCGTAACCCTAATAATATTGAAAAATTAATTGCTGAAGGTTTTATA
AAAGAAGGACAGAAAAATTGTAAATCCGGACAAACTATTAGTATTTCAAATGGTGAGGCTGTTGCGAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	86.408	100	0.864
comGC	Staphylococcus aureus MW2	86.408	100	0.864
comYC	Streptococcus gordonii str. Challis substr. CH1	46.602	100	0.466
comGC/cglC	Streptococcus mitis SK321	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae TIGR4	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae D39	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae R6	45.098	99.029	0.447
comGC/cglC	Streptococcus mitis NCTC 12261	50	83.495	0.417
comYC	Streptococcus mutans UA159	47.727	85.437	0.408
comYC	Streptococcus mutans UA140	47.727	85.437	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Lactococcus lactis subsp. cremoris KW2	49.367	76.699	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.304	89.32	0.369