Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | M9H69_RS10320 | Genome accession | NZ_CP097843 |
| Coordinates | 2059859..2059984 (-) | Length | 41 a.a. |
| NCBI ID | WP_195215739.1 | Uniprot ID | - |
| Organism | Streptococcus oralis strain HP01 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2054859..2064984
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9H69_RS10295 (M9H69_10295) | - | 2056988..2057530 (+) | 543 | WP_000665086.1 | TetR/AcrR family transcriptional regulator | - |
| M9H69_RS10310 (M9H69_10310) | comE | 2057770..2058522 (-) | 753 | WP_250315577.1 | competence system response regulator transcription factor ComE | Regulator |
| M9H69_RS10315 (M9H69_10315) | comD | 2058519..2059838 (-) | 1320 | WP_250315578.1 | competence system sensor histidine kinase ComD | Regulator |
| M9H69_RS10320 (M9H69_10320) | comC/comC2 | 2059859..2059984 (-) | 126 | WP_195215739.1 | competence-stimulating peptide ComC | Regulator |
| M9H69_RS10330 (M9H69_10330) | rlmH | 2060266..2060745 (-) | 480 | WP_250315579.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| M9H69_RS10335 (M9H69_10335) | htrA | 2060930..2062120 (+) | 1191 | WP_084911880.1 | S1C family serine protease | Regulator |
| M9H69_RS10340 (M9H69_10340) | spo0J | 2062178..2062936 (+) | 759 | WP_250315580.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4959.79 Da Isoelectric Point: 10.9293
>NTDB_id=692963 M9H69_RS10320 WP_195215739.1 2059859..2059984(-) (comC/comC2) [Streptococcus oralis strain HP01]
MKNTVKLEQFKEVTEAELQKIRGGDWRISETIRNLIFPRRK
MKNTVKLEQFKEVTEAELQKIRGGDWRISETIRNLIFPRRK
Nucleotide
Download Length: 126 bp
>NTDB_id=692963 M9H69_RS10320 WP_195215739.1 2059859..2059984(-) (comC/comC2) [Streptococcus oralis strain HP01]
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGAAGATTCGGGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGAAGATTCGGGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
58.537 |
100 |
0.585 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
58.537 |
100 |
0.585 |
| comC/comC1 | Streptococcus pneumoniae R6 |
56.098 |
100 |
0.561 |
| comC/comC1 | Streptococcus pneumoniae G54 |
56.098 |
100 |
0.561 |
| comC/comC1 | Streptococcus pneumoniae D39 |
56.098 |
100 |
0.561 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
56.098 |
100 |
0.561 |
| comC | Streptococcus mitis SK321 |
53.659 |
100 |
0.537 |
| comC | Streptococcus mitis NCTC 12261 |
47.5 |
97.561 |
0.463 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
43.243 |
90.244 |
0.39 |
| comC/comC1 | Streptococcus gordonii str. Challis substr. CH1 |
39.474 |
92.683 |
0.366 |