Detailed information NTG0689728

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: OTU45_RS10810
• Genome accession: NZ_CP113114
• Coordinates: 2095669..2095935 (-)
• Length: 88 a.a.
• NCBI ID: WP_050073122.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae strain NP1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2090669..2100935

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OTU45_RS10765 (OTU45_10765)	rnpA	2090686..2091057 (-)	372	WP_000739246.1	ribonuclease P protein component	-
OTU45_RS10770 (OTU45_10770)	-	2091074..2091205 (-)	132	WP_000768904.1	hypothetical protein	-
OTU45_RS10775 (OTU45_10775)	-	2091206..2092396 (-)	1191	WP_000167766.1	acetate kinase	-
OTU45_RS10780 (OTU45_10780)	comGH	2092447..2093400 (-)	954	WP_000345101.1	class I SAM-dependent methyltransferase	Machinery gene
OTU45_RS10785 (OTU45_10785)	-	2093461..2094055 (-)	595	Protein_2108	class I SAM-dependent methyltransferase	-
OTU45_RS10790 (OTU45_10790)	comGG/cglG	2094192..2094605 (-)	414	WP_000265624.1	competence type IV pilus minor pilin ComGG	Machinery gene
OTU45_RS10795 (OTU45_10795)	comGF/cglF	2094583..2095044 (-)	462	WP_000250542.1	competence type IV pilus minor pilin ComGF	Machinery gene
OTU45_RS10800 (OTU45_10800)	comGE/cglE	2095007..2095309 (-)	303	WP_000413382.1	competence type IV pilus minor pilin ComGE	Machinery gene
OTU45_RS10805 (OTU45_10805)	comGD/cglD	2095272..2095676 (-)	405	WP_000588013.1	competence type IV pilus minor pilin ComGD	Machinery gene
OTU45_RS10810 (OTU45_10810)	comGC/cglC	2095669..2095935 (-)	267	WP_050073122.1	competence type IV pilus major pilin ComGC	Machinery gene
OTU45_RS10815 (OTU45_10815)	-	2095937..2096194 (-)	258	WP_000698513.1	hypothetical protein	-
OTU45_RS10820 (OTU45_10820)	lytA	2096426..2097382 (-)	957	WP_054436120.1	N-acetylmuramoyl-L-alanine amidase LytA	-
OTU45_RS10825 (OTU45_10825)	-	2097382..2097717 (-)	336	WP_001186204.1	phage holin	-
OTU45_RS10830 (OTU45_10830)	-	2097721..2098020 (-)	300	WP_001811580.1	hypothetical protein	-
OTU45_RS10835 (OTU45_10835)	-	2098030..2098380 (-)	351	WP_054368148.1	hypothetical protein	-
OTU45_RS10840 (OTU45_10840)	-	2098383..2098586 (-)	204	WP_001091107.1	hypothetical protein	-
OTU45_RS10845 (OTU45_10845)	-	2098567..2098683 (-)	117	WP_001063632.1	hypothetical protein	-

Sequence

Protein

• Length: 88 a.a.
• Molecular weight: 9853.35 Da
• Isoelectric Point: 6.3588

>NTDB_id=689728 OTU45_RS10810 WP_050073122.1 2095669..2095935(-) (comGC/cglC) [Streptococcus pneumoniae strain NP1]
MLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLKEDGRITEEQAKAYKEYNDKNV
GANRKVND

Nucleotide

• Length: 267 bp

>NTDB_id=689728 OTU45_RS10810 WP_050073122.1 2095669..2095935(-) (comGC/cglC) [Streptococcus pneumoniae strain NP1]
ATGTTGGTGGTCTTGCTGATTATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAA
TGACAAAGGAAAAGCAGCTGTTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTA
GCCTAAGCAAGTTAAAAGAAGATGGACGCATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACAATGATAAAAATGTG
GGAGCAAATCGTAAAGTCAATGATTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus pneumoniae TIGR4	95.455	100	0.955
comGC/cglC	Streptococcus pneumoniae Rx1	94.318	100	0.943
comGC/cglC	Streptococcus pneumoniae D39	94.318	100	0.943
comGC/cglC	Streptococcus pneumoniae R6	94.318	100	0.943
comGC/cglC	Streptococcus mitis SK321	90.541	84.091	0.761
comGC/cglC	Streptococcus mitis NCTC 12261	92.188	72.727	0.67
comGC	Streptococcus gordonii str. Challis substr. CH1	71.25	90.909	0.648
comGC	Streptococcus suis isolate S10	65.278	81.818	0.534
comGC	Streptococcus mutans UA140	60	79.545	0.477
comGC	Streptococcus mutans UA159	60	79.545	0.477
comGC	Lactococcus lactis subsp. cremoris KW2	50.667	85.227	0.432
comGC	Staphylococcus aureus MW2	46.377	78.409	0.364
comGC	Staphylococcus aureus N315	46.377	78.409	0.364