Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | M3M41_RS05120 | Genome accession | NZ_CP097115 |
| Coordinates | 1049451..1049879 (+) | Length | 142 a.a. |
| NCBI ID | WP_000934783.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain JP18270 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1037026..1085189 | 1049451..1049879 | within | 0 |
Gene organization within MGE regions
Location: 1037026..1085189
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3M41_RS05005 (M3M41_05000) | - | 1037026..1037952 (-) | 927 | WP_000757569.1 | glycerophosphodiester phosphodiesterase | - |
| M3M41_RS05010 (M3M41_05005) | - | 1038191..1038445 (+) | 255 | WP_001049150.1 | YlbG family protein | - |
| M3M41_RS05015 (M3M41_05010) | - | 1038448..1038837 (-) | 390 | WP_000814565.1 | hypothetical protein | - |
| M3M41_RS05020 (M3M41_05015) | rsmD | 1038907..1039449 (+) | 543 | WP_001263796.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| M3M41_RS05025 (M3M41_05020) | coaD | 1039451..1039933 (+) | 483 | WP_000401377.1 | pantetheine-phosphate adenylyltransferase | - |
| M3M41_RS05030 (M3M41_05025) | - | 1039995..1041134 (-) | 1140 | WP_000843611.1 | nucleotidyltransferase | - |
| M3M41_RS05035 (M3M41_05030) | - | 1041261..1041818 (+) | 558 | WP_000872158.1 | DUF177 domain-containing protein | - |
| M3M41_RS05040 (M3M41_05035) | rpmF | 1041898..1042071 (+) | 174 | WP_000290472.1 | 50S ribosomal protein L32 | - |
| M3M41_RS05045 (M3M41_05040) | - | 1042188..1043573 (-) | 1386 | WP_000861313.1 | recombinase family protein | - |
| M3M41_RS05050 (M3M41_05045) | - | 1043681..1043881 (+) | 201 | WP_000143212.1 | excisionase | - |
| M3M41_RS05055 (M3M41_05050) | - | 1043818..1044723 (-) | 906 | WP_000391592.1 | hypothetical protein | - |
| M3M41_RS05060 (M3M41_05055) | - | 1044759..1044944 (-) | 186 | WP_000446801.1 | hypothetical protein | - |
| M3M41_RS05065 (M3M41_05060) | - | 1045104..1045271 (-) | 168 | WP_000705238.1 | hypothetical protein | - |
| M3M41_RS05070 (M3M41_05065) | - | 1045341..1046057 (-) | 717 | WP_015985261.1 | LexA family transcriptional regulator | - |
| M3M41_RS05075 (M3M41_05070) | - | 1046221..1046463 (+) | 243 | WP_000639922.1 | DUF739 family protein | - |
| M3M41_RS05080 (M3M41_05075) | - | 1046479..1047267 (+) | 789 | WP_001148565.1 | phage antirepressor KilAC domain-containing protein | - |
| M3M41_RS05085 (M3M41_05080) | - | 1047283..1047477 (+) | 195 | WP_015985262.1 | hypothetical protein | - |
| M3M41_RS05090 (M3M41_05085) | - | 1047681..1047911 (-) | 231 | WP_000395457.1 | hypothetical protein | - |
| M3M41_RS05095 (M3M41_05090) | - | 1047961..1048098 (+) | 138 | WP_000230552.1 | hypothetical protein | - |
| M3M41_RS05100 (M3M41_05095) | - | 1048091..1048252 (+) | 162 | WP_015985263.1 | DUF1270 family protein | - |
| M3M41_RS05105 (M3M41_05100) | - | 1048344..1048604 (+) | 261 | WP_015977975.1 | DUF1108 family protein | - |
| M3M41_RS05110 (M3M41_05105) | - | 1048614..1048835 (+) | 222 | WP_000815403.1 | DUF2483 family protein | - |
| M3M41_RS05115 (M3M41_05110) | - | 1048828..1049451 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| M3M41_RS05120 (M3M41_05115) | ssbA | 1049451..1049879 (+) | 429 | WP_000934783.1 | single-stranded DNA-binding protein | Machinery gene |
| M3M41_RS05125 (M3M41_05120) | - | 1049893..1050567 (+) | 675 | WP_015977703.1 | putative HNHc nuclease | - |
| M3M41_RS05130 (M3M41_05125) | - | 1050673..1051530 (-) | 858 | WP_000371250.1 | DUF4393 domain-containing protein | - |
| M3M41_RS05135 (M3M41_05130) | - | 1051646..1051792 (+) | 147 | Protein_1005 | conserved phage C-terminal domain-containing protein | - |
| M3M41_RS05140 (M3M41_05135) | - | 1051802..1052581 (+) | 780 | WP_000803062.1 | ATP-binding protein | - |
| M3M41_RS05145 (M3M41_05140) | - | 1052575..1052733 (+) | 159 | WP_000256589.1 | hypothetical protein | - |
| M3M41_RS05150 (M3M41_05145) | - | 1052746..1052967 (+) | 222 | WP_001123673.1 | DUF3269 family protein | - |
| M3M41_RS05155 (M3M41_05150) | - | 1052977..1053384 (+) | 408 | WP_000401950.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M3M41_RS05160 (M3M41_05155) | - | 1053384..1053569 (+) | 186 | WP_001187264.1 | DUF3113 family protein | - |
| M3M41_RS05165 (M3M41_05160) | - | 1053570..1053929 (+) | 360 | WP_015985264.1 | SA1788 family PVL leukocidin-associated protein | - |
| M3M41_RS05170 (M3M41_05165) | - | 1053930..1054178 (+) | 249 | WP_001126828.1 | SAV1978 family virulence-associated passenger protein | - |
| M3M41_RS05175 (M3M41_05170) | - | 1054193..1054594 (+) | 402 | WP_001614811.1 | hypothetical protein | - |
| M3M41_RS05180 (M3M41_05175) | - | 1054591..1054938 (+) | 348 | WP_000979209.1 | YopX family protein | - |
| M3M41_RS05185 (M3M41_05180) | - | 1054935..1055243 (+) | 309 | WP_015977973.1 | hypothetical protein | - |
| M3M41_RS05190 (M3M41_05185) | - | 1055236..1055472 (+) | 237 | WP_015985265.1 | DUF1024 family protein | - |
| M3M41_RS05195 (M3M41_05190) | - | 1055477..1055989 (+) | 513 | WP_015977971.1 | dUTP diphosphatase | - |
| M3M41_RS05200 (M3M41_05195) | - | 1056026..1056232 (+) | 207 | WP_015977976.1 | DUF1381 domain-containing protein | - |
| M3M41_RS05205 (M3M41_05200) | - | 1056229..1056432 (+) | 204 | WP_000141259.1 | hypothetical protein | - |
| M3M41_RS05210 (M3M41_05205) | - | 1056425..1056661 (+) | 237 | WP_015977974.1 | hypothetical protein | - |
| M3M41_RS05215 (M3M41_05210) | - | 1056651..1057040 (+) | 390 | WP_001596346.1 | hypothetical protein | - |
| M3M41_RS05220 (M3M41_05215) | rinB | 1057037..1057210 (+) | 174 | WP_015977977.1 | transcriptional activator RinB | - |
| M3M41_RS05225 (M3M41_05220) | - | 1057211..1057357 (+) | 147 | WP_000990005.1 | hypothetical protein | - |
| M3M41_RS05230 (M3M41_05225) | - | 1057381..1057803 (+) | 423 | WP_000162696.1 | RinA family phage transcriptional activator | - |
| M3M41_RS05235 (M3M41_05230) | - | 1057990..1058430 (+) | 441 | WP_001003271.1 | terminase small subunit | - |
| M3M41_RS05240 (M3M41_05235) | - | 1058417..1059694 (+) | 1278 | WP_000169946.1 | PBSX family phage terminase large subunit | - |
| M3M41_RS05245 (M3M41_05240) | - | 1059705..1061240 (+) | 1536 | WP_001652961.1 | phage portal protein | - |
| M3M41_RS05250 (M3M41_05245) | - | 1061247..1062242 (+) | 996 | WP_001133043.1 | minor capsid protein | - |
| M3M41_RS05255 (M3M41_05250) | - | 1062315..1062485 (+) | 171 | WP_000072205.1 | hypothetical protein | - |
| M3M41_RS05260 (M3M41_05255) | - | 1062513..1062600 (+) | 88 | Protein_1030 | hypothetical protein | - |
| M3M41_RS05265 (M3M41_05260) | - | 1062594..1063214 (+) | 621 | WP_000392141.1 | DUF4355 domain-containing protein | - |
| M3M41_RS05270 (M3M41_05265) | - | 1063228..1064202 (+) | 975 | WP_015977968.1 | phage major capsid protein | - |
| M3M41_RS05275 (M3M41_05270) | - | 1064224..1064511 (+) | 288 | WP_001114085.1 | hypothetical protein | - |
| M3M41_RS05280 (M3M41_05275) | - | 1064520..1064852 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| M3M41_RS05285 (M3M41_05280) | - | 1064849..1065151 (+) | 303 | WP_001268312.1 | hypothetical protein | - |
| M3M41_RS05290 (M3M41_05285) | - | 1065151..1065498 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| M3M41_RS05295 (M3M41_05290) | - | 1065510..1065893 (+) | 384 | WP_015977972.1 | hypothetical protein | - |
| M3M41_RS05300 (M3M41_05295) | - | 1065912..1066493 (+) | 582 | WP_015977970.1 | phage major tail protein, TP901-1 family | - |
| M3M41_RS05305 (M3M41_05300) | - | 1066555..1066920 (+) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| M3M41_RS05310 (M3M41_05305) | - | 1066950..1067294 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| M3M41_RS05315 (M3M41_05310) | - | 1067311..1070775 (+) | 3465 | WP_000141470.1 | hypothetical protein | - |
| M3M41_RS05320 (M3M41_05315) | - | 1070788..1071735 (+) | 948 | WP_015985267.1 | phage tail family protein | - |
| M3M41_RS05325 (M3M41_05320) | - | 1071744..1073645 (+) | 1902 | WP_015977964.1 | SGNH/GDSL hydrolase family protein | - |
| M3M41_RS05330 (M3M41_05325) | - | 1073660..1075570 (+) | 1911 | WP_001668931.1 | hypothetical protein | - |
| M3M41_RS05335 (M3M41_05330) | - | 1075570..1077393 (+) | 1824 | WP_015985268.1 | phage baseplate upper protein | - |
| M3M41_RS05340 (M3M41_05335) | - | 1077393..1077770 (+) | 378 | WP_000705919.1 | DUF2977 domain-containing protein | - |
| M3M41_RS05345 (M3M41_05340) | - | 1077780..1077953 (+) | 174 | WP_015990323.1 | XkdX family protein | - |
| M3M41_RS05350 (M3M41_05345) | - | 1077994..1078293 (+) | 300 | WP_015985270.1 | DUF2951 domain-containing protein | - |
| M3M41_RS05355 (M3M41_05350) | - | 1078430..1080328 (+) | 1899 | WP_015985271.1 | glucosaminidase domain-containing protein | - |
| M3M41_RS05360 (M3M41_05355) | - | 1080341..1081513 (+) | 1173 | WP_000276627.1 | BppU family phage baseplate upper protein | - |
| M3M41_RS05365 (M3M41_05360) | - | 1081519..1081914 (+) | 396 | WP_000398878.1 | hypothetical protein | - |
| M3M41_RS05370 (M3M41_05365) | - | 1081970..1082272 (+) | 303 | WP_000339146.1 | phage holin | - |
| M3M41_RS05375 (M3M41_05370) | - | 1082284..1083738 (+) | 1455 | WP_000930256.1 | N-acetylmuramoyl-L-alanine amidase | - |
| M3M41_RS05380 (M3M41_05375) | - | 1084353..1085189 (+) | 837 | WP_000675478.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16047.61 Da Isoelectric Point: 5.8724
>NTDB_id=687231 M3M41_RS05120 WP_000934783.1 1049451..1049879(+) (ssbA) [Staphylococcus aureus strain JP18270]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAIIDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAIIDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=687231 M3M41_RS05120 WP_000934783.1 1049451..1049879(+) (ssbA) [Staphylococcus aureus strain JP18270]
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTATTGATGATGACTTACCGTTCTGA
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTATTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.657 |
100 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
46.957 |
80.986 |
0.38 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.763 |
83.099 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.763 |
83.099 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.915 |
83.099 |
0.373 |