Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M1B70_RS07090 | Genome accession | NZ_CP096571 |
| Coordinates | 1395115..1395540 (-) | Length | 141 a.a. |
| NCBI ID | WP_248616990.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain BB2-4M | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1360458..1414807 | 1395115..1395540 | within | 0 |
Gene organization within MGE regions
Location: 1360458..1414807
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1B70_RS06880 (M1B70_06880) | - | 1360458..1360646 (-) | 189 | WP_008842200.1 | hypothetical protein | - |
| M1B70_RS06885 (M1B70_06885) | - | 1360862..1363069 (+) | 2208 | WP_128211738.1 | ATP-dependent Clp protease ATP-binding subunit | - |
| M1B70_RS06890 (M1B70_06890) | - | 1363399..1364376 (-) | 978 | WP_005917413.1 | GMP reductase | - |
| M1B70_RS06895 (M1B70_06895) | - | 1365306..1366436 (-) | 1131 | WP_248616957.1 | peptidoglycan recognition family protein | - |
| M1B70_RS06900 (M1B70_06900) | - | 1366420..1366662 (-) | 243 | WP_248616958.1 | phage holin | - |
| M1B70_RS06905 (M1B70_06905) | - | 1366662..1366889 (-) | 228 | WP_248616959.1 | hypothetical protein | - |
| M1B70_RS06910 (M1B70_06910) | - | 1366996..1367127 (-) | 132 | WP_248616960.1 | XkdX family protein | - |
| M1B70_RS06915 (M1B70_06915) | - | 1367127..1367453 (-) | 327 | WP_248616961.1 | DUF2977 domain-containing protein | - |
| M1B70_RS06920 (M1B70_06920) | - | 1367475..1368203 (-) | 729 | WP_248616962.1 | hypothetical protein | - |
| M1B70_RS06925 (M1B70_06925) | - | 1368215..1370110 (-) | 1896 | WP_248616963.1 | metallophosphoesterase | - |
| M1B70_RS06930 (M1B70_06930) | - | 1370110..1370385 (-) | 276 | WP_248616964.1 | hypothetical protein | - |
| M1B70_RS06935 (M1B70_06935) | - | 1370375..1370701 (-) | 327 | WP_248616965.1 | hypothetical protein | - |
| M1B70_RS06940 (M1B70_06940) | - | 1370691..1371827 (-) | 1137 | WP_248616966.1 | phage tail protein | - |
| M1B70_RS06945 (M1B70_06945) | - | 1371837..1372721 (-) | 885 | WP_248616967.1 | phage tail domain-containing protein | - |
| M1B70_RS06950 (M1B70_06950) | - | 1372687..1377954 (-) | 5268 | WP_248616968.1 | tape measure protein | - |
| M1B70_RS06955 (M1B70_06955) | - | 1377958..1378590 (-) | 633 | WP_248616969.1 | Gp15 family bacteriophage protein | - |
| M1B70_RS06960 (M1B70_06960) | - | 1378597..1379034 (-) | 438 | WP_248616970.1 | hypothetical protein | - |
| M1B70_RS06965 (M1B70_06965) | - | 1379108..1379641 (-) | 534 | WP_248616971.1 | capsid protein | - |
| M1B70_RS06970 (M1B70_06970) | - | 1379645..1380040 (-) | 396 | WP_248616972.1 | minor capsid protein | - |
| M1B70_RS06975 (M1B70_06975) | - | 1380027..1380377 (-) | 351 | WP_248616973.1 | minor capsid protein | - |
| M1B70_RS06980 (M1B70_06980) | - | 1380377..1380724 (-) | 348 | WP_248616974.1 | putative minor capsid protein | - |
| M1B70_RS06985 (M1B70_06985) | - | 1380721..1381137 (-) | 417 | WP_248616975.1 | hypothetical protein | - |
| M1B70_RS06990 (M1B70_06990) | - | 1381149..1381892 (-) | 744 | WP_248616976.1 | Ig-like domain-containing protein | - |
| M1B70_RS06995 (M1B70_06995) | - | 1381970..1382863 (-) | 894 | WP_248616977.1 | hypothetical protein | - |
| M1B70_RS07000 (M1B70_07000) | - | 1382876..1383436 (-) | 561 | WP_248616978.1 | phage scaffolding protein | - |
| M1B70_RS07005 (M1B70_07005) | - | 1383529..1384662 (-) | 1134 | WP_345894684.1 | phage minor capsid protein | - |
| M1B70_RS07010 (M1B70_07010) | - | 1384659..1386155 (-) | 1497 | WP_248616980.1 | phage portal protein | - |
| M1B70_RS07015 (M1B70_07015) | - | 1386209..1387573 (-) | 1365 | WP_248617106.1 | PBSX family phage terminase large subunit | - |
| M1B70_RS07020 (M1B70_07020) | - | 1387579..1388148 (-) | 570 | WP_248616981.1 | terminase small subunit | - |
| M1B70_RS07025 (M1B70_07025) | - | 1388655..1389098 (-) | 444 | WP_159212218.1 | hypothetical protein | - |
| M1B70_RS07030 (M1B70_07030) | - | 1389205..1389441 (-) | 237 | WP_248616982.1 | hypothetical protein | - |
| M1B70_RS10455 | - | 1389416..1389550 (-) | 135 | WP_282581312.1 | hypothetical protein | - |
| M1B70_RS07035 (M1B70_07035) | - | 1389613..1389789 (-) | 177 | WP_248616983.1 | hypothetical protein | - |
| M1B70_RS07040 (M1B70_07040) | - | 1389852..1390034 (-) | 183 | WP_248616984.1 | hypothetical protein | - |
| M1B70_RS07045 (M1B70_07045) | - | 1390108..1390479 (-) | 372 | WP_248616985.1 | N-acetylmuramoyl-L-alanine amidase | - |
| M1B70_RS07050 (M1B70_07050) | - | 1390466..1390615 (-) | 150 | WP_193223200.1 | hypothetical protein | - |
| M1B70_RS07055 (M1B70_07055) | - | 1390646..1391266 (-) | 621 | WP_248616986.1 | RNA polymerase subunit sigma-70 | - |
| M1B70_RS07060 (M1B70_07060) | - | 1391266..1391493 (-) | 228 | WP_248616987.1 | hypothetical protein | - |
| M1B70_RS07065 (M1B70_07065) | - | 1391493..1391924 (-) | 432 | WP_138492822.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M1B70_RS07070 (M1B70_07070) | - | 1391921..1392328 (-) | 408 | WP_235019052.1 | hypothetical protein | - |
| M1B70_RS07075 (M1B70_07075) | - | 1392337..1393569 (-) | 1233 | WP_138492820.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| M1B70_RS07080 (M1B70_07080) | - | 1393559..1394425 (-) | 867 | WP_248616988.1 | conserved phage C-terminal domain-containing protein | - |
| M1B70_RS07085 (M1B70_07085) | - | 1394403..1395104 (-) | 702 | WP_248616989.1 | putative HNHc nuclease | - |
| M1B70_RS07090 (M1B70_07090) | ssb | 1395115..1395540 (-) | 426 | WP_248616990.1 | single-stranded DNA-binding protein | Machinery gene |
| M1B70_RS07095 (M1B70_07095) | - | 1395533..1396225 (-) | 693 | WP_248616991.1 | ERF family protein | - |
| M1B70_RS07100 (M1B70_07100) | - | 1396232..1396690 (-) | 459 | WP_248616992.1 | chromosome segregation protein SMC | - |
| M1B70_RS07105 (M1B70_07105) | - | 1396849..1397070 (-) | 222 | WP_248616993.1 | hypothetical protein | - |
| M1B70_RS07110 (M1B70_07110) | - | 1397167..1397505 (-) | 339 | WP_195459571.1 | DUF771 domain-containing protein | - |
| M1B70_RS07115 (M1B70_07115) | - | 1397519..1398250 (-) | 732 | WP_248616994.1 | Rha family transcriptional regulator | - |
| M1B70_RS07120 (M1B70_07120) | - | 1398381..1398584 (-) | 204 | WP_248616995.1 | hypothetical protein | - |
| M1B70_RS07125 (M1B70_07125) | - | 1398870..1399211 (+) | 342 | WP_248616996.1 | helix-turn-helix transcriptional regulator | - |
| M1B70_RS07130 (M1B70_07130) | - | 1399218..1399628 (+) | 411 | WP_053905908.1 | hypothetical protein | - |
| M1B70_RS07135 (M1B70_07135) | - | 1399694..1400155 (+) | 462 | WP_248616997.1 | hypothetical protein | - |
| M1B70_RS07140 (M1B70_07140) | - | 1400374..1401510 (+) | 1137 | WP_248616998.1 | site-specific integrase | - |
| M1B70_RS07150 (M1B70_07150) | - | 1401916..1402170 (-) | 255 | WP_002829785.1 | helix-turn-helix domain-containing protein | - |
| M1B70_RS07155 (M1B70_07155) | - | 1402454..1402690 (-) | 237 | WP_024862481.1 | hypothetical protein | - |
| M1B70_RS07160 (M1B70_07160) | - | 1402702..1403733 (-) | 1032 | WP_005917417.1 | LCP family protein | - |
| M1B70_RS07165 (M1B70_07165) | - | 1403827..1405143 (-) | 1317 | WP_008842199.1 | DEAD/DEAH box helicase | - |
| M1B70_RS07170 (M1B70_07170) | - | 1405150..1406157 (-) | 1008 | WP_087115683.1 | Gfo/Idh/MocA family oxidoreductase | - |
| M1B70_RS07175 (M1B70_07175) | - | 1406469..1406849 (+) | 381 | WP_087115684.1 | DUF4828 domain-containing protein | - |
| M1B70_RS07180 (M1B70_07180) | - | 1406890..1407657 (-) | 768 | WP_087115685.1 | GH25 family lysozyme | - |
| M1B70_RS07185 (M1B70_07185) | - | 1407776..1409098 (+) | 1323 | WP_002829794.1 | amino acid permease | - |
| M1B70_RS07190 (M1B70_07190) | - | 1409132..1409659 (+) | 528 | WP_005917432.1 | VanZ family protein | - |
| M1B70_RS07195 (M1B70_07195) | - | 1409852..1411777 (-) | 1926 | WP_128211688.1 | copper-translocating P-type ATPase | - |
| M1B70_RS07200 (M1B70_07200) | - | 1411777..1412049 (-) | 273 | WP_070366755.1 | cupredoxin domain-containing protein | - |
| M1B70_RS07205 (M1B70_07205) | - | 1412068..1412442 (-) | 375 | WP_002829798.1 | cupredoxin domain-containing protein | - |
| M1B70_RS07210 (M1B70_07210) | - | 1412443..1412898 (-) | 456 | WP_005917440.1 | CopY/TcrY family copper transport repressor | - |
| M1B70_RS07215 (M1B70_07215) | - | 1413051..1413962 (+) | 912 | WP_128211690.1 | exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | - |
| M1B70_RS07220 (M1B70_07220) | - | 1413962..1414807 (+) | 846 | WP_128211692.1 | DNA/RNA non-specific endonuclease | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15584.31 Da Isoelectric Point: 7.9972
>NTDB_id=681804 M1B70_RS07090 WP_248616990.1 1395115..1395540(-) (ssb) [Pediococcus acidilactici strain BB2-4M]
MINRTVLIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYAQKGSLVGIEGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNTRQASTPGDPFANGGQSIDIGDDSLPF
MINRTVLIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYAQKGSLVGIEGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNTRQASTPGDPFANGGQSIDIGDDSLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=681804 M1B70_RS07090 WP_248616990.1 1395115..1395540(-) (ssb) [Pediococcus acidilactici strain BB2-4M]
ATGATTAATCGAACAGTACTAATAGGACGTTTAACTAAAGATGTTGAGCTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCGGATTTCATCAACTGTGTAATGT
GGCGTAAGGCAGCAGAAAACTTTGCTAAGTATGCACAAAAAGGTTCGTTGGTAGGTATTGAAGGGCGGATTCAGACCCGT
TCATACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCGGATAACTTCTCGTTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAACACACGGCAAGCATCAACGCCAGGAGATCCATTCGCTAATGGCGGGCAGTCAATTGATA
TTGGTGACGATAGTTTGCCTTTCTAA
ATGATTAATCGAACAGTACTAATAGGACGTTTAACTAAAGATGTTGAGCTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCGGATTTCATCAACTGTGTAATGT
GGCGTAAGGCAGCAGAAAACTTTGCTAAGTATGCACAAAAAGGTTCGTTGGTAGGTATTGAAGGGCGGATTCAGACCCGT
TCATACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCGGATAACTTCTCGTTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAACACACGGCAAGCATCAACGCCAGGAGATCCATTCGCTAATGGCGGGCAGTCAATTGATA
TTGGTGACGATAGTTTGCCTTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.647 |
100 |
0.695 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
53.488 |
100 |
0.652 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
62.037 |
76.596 |
0.475 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.972 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.972 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.278 |
100 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.278 |
100 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.278 |
100 |
0.411 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.278 |
100 |
0.411 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
47.826 |
81.56 |
0.39 |
| ssbA | Streptococcus mutans UA159 |
37.324 |
100 |
0.376 |