Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M1B70_RS06545 | Genome accession | NZ_CP096571 |
| Coordinates | 1313100..1313525 (-) | Length | 141 a.a. |
| NCBI ID | WP_248616949.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain BB2-4M | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1280479..1321076 | 1313100..1313525 | within | 0 |
Gene organization within MGE regions
Location: 1280479..1321076
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1B70_RS06330 (M1B70_06330) | - | 1280479..1281987 (-) | 1509 | WP_159215494.1 | sodium:solute symporter | - |
| M1B70_RS06335 (M1B70_06335) | - | 1282241..1282972 (-) | 732 | WP_128211971.1 | TIM barrel protein | - |
| M1B70_RS06340 (M1B70_06340) | - | 1282953..1283801 (-) | 849 | WP_075139827.1 | ROK family protein | - |
| M1B70_RS06345 (M1B70_06345) | - | 1284545..1285873 (-) | 1329 | WP_248616916.1 | GH25 family lysozyme | - |
| M1B70_RS06350 (M1B70_06350) | - | 1285854..1286105 (-) | 252 | WP_248616917.1 | phage holin | - |
| M1B70_RS06355 (M1B70_06355) | - | 1286105..1286395 (-) | 291 | WP_248616918.1 | hypothetical protein | - |
| M1B70_RS06360 (M1B70_06360) | - | 1286442..1287044 (-) | 603 | WP_248616919.1 | hypothetical protein | - |
| M1B70_RS06365 (M1B70_06365) | - | 1287106..1287237 (-) | 132 | WP_248616920.1 | XkdX family protein | - |
| M1B70_RS06370 (M1B70_06370) | - | 1287237..1287563 (-) | 327 | WP_248616921.1 | DUF2977 domain-containing protein | - |
| M1B70_RS06375 (M1B70_06375) | - | 1287585..1288313 (-) | 729 | WP_248616922.1 | hypothetical protein | - |
| M1B70_RS06380 (M1B70_06380) | - | 1288325..1290211 (-) | 1887 | WP_248616923.1 | BppU family phage baseplate upper protein | - |
| M1B70_RS06385 (M1B70_06385) | - | 1290215..1290661 (-) | 447 | WP_248616924.1 | hypothetical protein | - |
| M1B70_RS06390 (M1B70_06390) | - | 1290645..1293605 (-) | 2961 | WP_248616925.1 | phage tail protein | - |
| M1B70_RS06395 (M1B70_06395) | - | 1293605..1294369 (-) | 765 | WP_248616926.1 | phage tail protein | - |
| M1B70_RS06400 (M1B70_06400) | - | 1294369..1297020 (-) | 2652 | WP_248616927.1 | phage tail tape measure protein | - |
| M1B70_RS06405 (M1B70_06405) | - | 1297004..1297282 (-) | 279 | WP_248616928.1 | hypothetical protein | - |
| M1B70_RS06410 (M1B70_06410) | - | 1297429..1297770 (-) | 342 | WP_199874682.1 | tail assembly chaperone | - |
| M1B70_RS06415 (M1B70_06415) | - | 1297842..1298474 (-) | 633 | WP_248616929.1 | phage major tail protein, TP901-1 family | - |
| M1B70_RS06420 (M1B70_06420) | - | 1298487..1298894 (-) | 408 | WP_248616930.1 | hypothetical protein | - |
| M1B70_RS06425 (M1B70_06425) | - | 1298895..1299236 (-) | 342 | WP_248616931.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| M1B70_RS06430 (M1B70_06430) | - | 1299229..1299546 (-) | 318 | WP_248616932.1 | hypothetical protein | - |
| M1B70_RS06435 (M1B70_06435) | - | 1299551..1299925 (-) | 375 | WP_248616933.1 | phage head-tail connector protein | - |
| M1B70_RS06440 (M1B70_06440) | - | 1299937..1300203 (-) | 267 | WP_128472106.1 | Ig-like domain-containing protein | - |
| M1B70_RS06445 (M1B70_06445) | - | 1300221..1301039 (-) | 819 | WP_248616934.1 | N4-gp56 family major capsid protein | - |
| M1B70_RS06450 (M1B70_06450) | - | 1301039..1301692 (-) | 654 | WP_248616935.1 | DUF4355 domain-containing protein | - |
| M1B70_RS06455 (M1B70_06455) | - | 1301798..1302769 (-) | 972 | WP_248616936.1 | minor capsid protein | - |
| M1B70_RS06460 (M1B70_06460) | - | 1302753..1304033 (-) | 1281 | WP_248617103.1 | phage portal protein | - |
| M1B70_RS06465 (M1B70_06465) | - | 1304154..1305500 (-) | 1347 | WP_248616937.1 | PBSX family phage terminase large subunit | - |
| M1B70_RS06470 (M1B70_06470) | - | 1305493..1305984 (-) | 492 | WP_248616938.1 | terminase small subunit | - |
| M1B70_RS06475 (M1B70_06475) | - | 1306246..1306689 (-) | 444 | WP_248616939.1 | hypothetical protein | - |
| M1B70_RS06480 (M1B70_06480) | - | 1306797..1307033 (-) | 237 | WP_248616940.1 | hypothetical protein | - |
| M1B70_RS06485 (M1B70_06485) | - | 1307033..1307341 (-) | 309 | WP_248616941.1 | hypothetical protein | - |
| M1B70_RS06490 (M1B70_06490) | - | 1307451..1307627 (-) | 177 | WP_159219778.1 | hypothetical protein | - |
| M1B70_RS06495 (M1B70_06495) | - | 1307635..1308138 (-) | 504 | WP_248616942.1 | DUF1642 domain-containing protein | - |
| M1B70_RS06500 (M1B70_06500) | - | 1308308..1308679 (-) | 372 | WP_248616943.1 | N-acetylmuramoyl-L-alanine amidase | - |
| M1B70_RS06505 (M1B70_06505) | - | 1308666..1308815 (-) | 150 | WP_248616944.1 | hypothetical protein | - |
| M1B70_RS06510 (M1B70_06510) | - | 1308818..1309000 (-) | 183 | WP_248616945.1 | hypothetical protein | - |
| M1B70_RS06515 (M1B70_06515) | - | 1309000..1309227 (-) | 228 | WP_160185815.1 | hypothetical protein | - |
| M1B70_RS06520 (M1B70_06520) | - | 1309439..1309909 (-) | 471 | WP_160185814.1 | hypothetical protein | - |
| M1B70_RS06525 (M1B70_06525) | - | 1309906..1310313 (-) | 408 | WP_248617105.1 | hypothetical protein | - |
| M1B70_RS06530 (M1B70_06530) | - | 1310322..1311554 (-) | 1233 | WP_248616946.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| M1B70_RS06535 (M1B70_06535) | - | 1311544..1312410 (-) | 867 | WP_248616947.1 | conserved phage C-terminal domain-containing protein | - |
| M1B70_RS06540 (M1B70_06540) | - | 1312388..1313089 (-) | 702 | WP_248616948.1 | putative HNHc nuclease | - |
| M1B70_RS06545 (M1B70_06545) | ssb | 1313100..1313525 (-) | 426 | WP_248616949.1 | single-stranded DNA-binding protein | Machinery gene |
| M1B70_RS06550 (M1B70_06550) | - | 1313518..1314216 (-) | 699 | WP_248616950.1 | ERF family protein | - |
| M1B70_RS06555 (M1B70_06555) | - | 1314217..1314672 (-) | 456 | WP_248616951.1 | chromosome segregation protein SMC | - |
| M1B70_RS06560 (M1B70_06560) | - | 1314895..1315176 (+) | 282 | WP_002830747.1 | hypothetical protein | - |
| M1B70_RS06565 (M1B70_06565) | - | 1315173..1315394 (-) | 222 | WP_193223205.1 | hypothetical protein | - |
| M1B70_RS06570 (M1B70_06570) | - | 1315491..1315697 (-) | 207 | WP_036672525.1 | hypothetical protein | - |
| M1B70_RS06575 (M1B70_06575) | - | 1315766..1316500 (-) | 735 | WP_248616952.1 | Rha family transcriptional regulator | - |
| M1B70_RS06580 (M1B70_06580) | - | 1316515..1316703 (-) | 189 | WP_128688467.1 | hypothetical protein | - |
| M1B70_RS06585 (M1B70_06585) | - | 1316969..1317307 (+) | 339 | WP_248616953.1 | XRE family transcriptional regulator | - |
| M1B70_RS06590 (M1B70_06590) | - | 1317314..1317724 (+) | 411 | WP_248616954.1 | hypothetical protein | - |
| M1B70_RS06595 (M1B70_06595) | - | 1317786..1318325 (+) | 540 | WP_248616955.1 | Ltp family lipoprotein | - |
| M1B70_RS06600 (M1B70_06600) | - | 1318361..1318765 (+) | 405 | WP_195459564.1 | hypothetical protein | - |
| M1B70_RS06605 (M1B70_06605) | - | 1318913..1319992 (+) | 1080 | WP_248616956.1 | site-specific integrase | - |
| M1B70_RS06610 (M1B70_06610) | - | 1320387..1321076 (+) | 690 | WP_053906494.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15568.31 Da Isoelectric Point: 7.9971
>NTDB_id=681802 M1B70_RS06545 WP_248616949.1 1313100..1313525(-) (ssb) [Pediococcus acidilactici strain BB2-4M]
MINRTVLIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFVKYAQKGSLVGIDGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDPFANGGQSIDIGDDSLPF
MINRTVLIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFVKYAQKGSLVGIDGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDPFANGGQSIDIGDDSLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=681802 M1B70_RS06545 WP_248616949.1 1313100..1313525(-) (ssb) [Pediococcus acidilactici strain BB2-4M]
ATGATTAATCGAACAGTACTAATAGGACGTTTAACTAAAGATGTTGAACTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGCGAAGCGGATTTCATCAACTGTGTAATGT
GGCGTAAGGCAGCAGAAAACTTTGTTAAGTATGCACAAAAAGGTTCGTTGGTAGGTATTGACGGTCGAATTCAGACCCGT
TCATACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCGTTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAACGCACGGCAAGCATCAACGCCGGGAGATCCATTCGCTAATGGCGGGCAGTCAATTGATA
TTGGTGACGATAGTTTGCCTTTCTAA
ATGATTAATCGAACAGTACTAATAGGACGTTTAACTAAAGATGTTGAACTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGCGAAGCGGATTTCATCAACTGTGTAATGT
GGCGTAAGGCAGCAGAAAACTTTGTTAAGTATGCACAAAAAGGTTCGTTGGTAGGTATTGACGGTCGAATTCAGACCCGT
TCATACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCGTTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAACGCACGGCAAGCATCAACGCCGGGAGATCCATTCGCTAATGGCGGGCAGTCAATTGATA
TTGGTGACGATAGTTTGCCTTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.647 |
100 |
0.695 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
53.488 |
100 |
0.652 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
61.111 |
76.596 |
0.468 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.958 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.549 |
100 |
0.418 |
| ssbA | Streptococcus mutans UA159 |
37.324 |
100 |
0.376 |