Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M1B70_RS03850 | Genome accession | NZ_CP096571 |
| Coordinates | 772901..773326 (+) | Length | 141 a.a. |
| NCBI ID | WP_128211868.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain BB2-4M | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 763884..802578 | 772901..773326 | within | 0 |
Gene organization within MGE regions
Location: 763884..802578
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1B70_RS03770 (M1B70_03770) | - | 763884..764999 (-) | 1116 | WP_128212073.1 | site-specific integrase | - |
| M1B70_RS03775 (M1B70_03775) | - | 765223..765420 (-) | 198 | WP_053905909.1 | hypothetical protein | - |
| M1B70_RS03780 (M1B70_03780) | - | 765567..766694 (-) | 1128 | WP_159215548.1 | hypothetical protein | - |
| M1B70_RS03785 (M1B70_03785) | - | 766757..767164 (-) | 408 | WP_128212081.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M1B70_RS03790 (M1B70_03790) | - | 767173..767514 (-) | 342 | WP_002831842.1 | helix-turn-helix transcriptional regulator | - |
| M1B70_RS03795 (M1B70_03795) | - | 767771..767977 (+) | 207 | WP_159215549.1 | hypothetical protein | - |
| M1B70_RS03800 (M1B70_03800) | - | 767967..768275 (-) | 309 | WP_128211981.1 | hypothetical protein | - |
| M1B70_RS03805 (M1B70_03805) | - | 768334..768552 (+) | 219 | WP_235016628.1 | helix-turn-helix transcriptional regulator | - |
| M1B70_RS03810 (M1B70_03810) | - | 768566..768703 (+) | 138 | WP_159215550.1 | hypothetical protein | - |
| M1B70_RS03815 (M1B70_03815) | - | 768695..768889 (-) | 195 | WP_128211983.1 | hypothetical protein | - |
| M1B70_RS03820 (M1B70_03820) | - | 768995..769777 (+) | 783 | WP_128211989.1 | phage antirepressor | - |
| M1B70_RS03825 (M1B70_03825) | - | 770056..770403 (+) | 348 | WP_229092966.1 | DUF771 domain-containing protein | - |
| M1B70_RS03830 (M1B70_03830) | - | 770504..770758 (+) | 255 | WP_128211987.1 | hypothetical protein | - |
| M1B70_RS03835 (M1B70_03835) | - | 770868..771530 (-) | 663 | WP_159215551.1 | hypothetical protein | - |
| M1B70_RS03840 (M1B70_03840) | - | 771754..772209 (+) | 456 | WP_128211872.1 | chromosome segregation protein SMC | - |
| M1B70_RS03845 (M1B70_03845) | - | 772210..772908 (+) | 699 | WP_128211870.1 | ERF family protein | - |
| M1B70_RS03850 (M1B70_03850) | ssb | 772901..773326 (+) | 426 | WP_128211868.1 | single-stranded DNA-binding protein | Machinery gene |
| M1B70_RS03855 (M1B70_03855) | - | 773338..774021 (+) | 684 | WP_128211866.1 | putative HNHc nuclease | - |
| M1B70_RS03860 (M1B70_03860) | - | 774005..774235 (+) | 231 | WP_128211864.1 | hypothetical protein | - |
| M1B70_RS03865 (M1B70_03865) | - | 774274..775026 (+) | 753 | WP_128211862.1 | conserved phage C-terminal domain-containing protein | - |
| M1B70_RS03870 (M1B70_03870) | - | 775178..775822 (+) | 645 | WP_229092964.1 | ATP-binding protein | - |
| M1B70_RS03875 (M1B70_03875) | - | 775940..776572 (+) | 633 | WP_128211858.1 | RNA polymerase subunit sigma-70 | - |
| M1B70_RS03880 (M1B70_03880) | - | 776553..776954 (+) | 402 | WP_128211856.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M1B70_RS03885 (M1B70_03885) | - | 776951..777100 (+) | 150 | WP_164873659.1 | hypothetical protein | - |
| M1B70_RS03890 (M1B70_03890) | - | 777087..777458 (+) | 372 | WP_128211854.1 | N-acetylmuramoyl-L-alanine amidase | - |
| M1B70_RS03895 (M1B70_03895) | - | 777461..777601 (+) | 141 | WP_159215552.1 | hypothetical protein | - |
| M1B70_RS03900 (M1B70_03900) | - | 777601..777801 (+) | 201 | WP_128211852.1 | hypothetical protein | - |
| M1B70_RS03905 (M1B70_03905) | - | 777818..778183 (+) | 366 | WP_159215553.1 | hypothetical protein | - |
| M1B70_RS03910 (M1B70_03910) | - | 778187..778495 (+) | 309 | WP_200834124.1 | hypothetical protein | - |
| M1B70_RS03915 (M1B70_03915) | - | 778509..778772 (+) | 264 | WP_128211995.1 | hypothetical protein | - |
| M1B70_RS03920 (M1B70_03920) | - | 779109..779543 (+) | 435 | WP_128211997.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| M1B70_RS03925 (M1B70_03925) | - | 779765..780085 (+) | 321 | WP_159215554.1 | bacteriocin immunity protein | - |
| M1B70_RS03930 (M1B70_03930) | - | 780170..780625 (+) | 456 | WP_128212001.1 | HNH endonuclease signature motif containing protein | - |
| M1B70_RS03935 (M1B70_03935) | - | 780622..780921 (+) | 300 | WP_128212003.1 | hypothetical protein | - |
| M1B70_RS03940 (M1B70_03940) | - | 781120..781584 (+) | 465 | WP_128211816.1 | phage terminase small subunit P27 family | - |
| M1B70_RS03945 (M1B70_03945) | - | 781584..783458 (+) | 1875 | WP_159215555.1 | terminase TerL endonuclease subunit | - |
| M1B70_RS03950 (M1B70_03950) | - | 783659..784771 (+) | 1113 | WP_128211812.1 | phage portal protein | - |
| M1B70_RS03955 (M1B70_03955) | - | 784752..785345 (+) | 594 | WP_230312667.1 | HK97 family phage prohead protease | - |
| M1B70_RS03960 (M1B70_03960) | - | 785346..786680 (+) | 1335 | WP_230312668.1 | phage major capsid protein | - |
| M1B70_RS03965 (M1B70_03965) | - | 786763..787233 (+) | 471 | WP_128211810.1 | Ig-like domain-containing protein | - |
| M1B70_RS03970 (M1B70_03970) | - | 787249..787572 (+) | 324 | WP_128211808.1 | head-tail connector protein | - |
| M1B70_RS03975 (M1B70_03975) | - | 787562..787909 (+) | 348 | WP_229092888.1 | phage head closure protein | - |
| M1B70_RS03980 (M1B70_03980) | - | 787909..788322 (+) | 414 | WP_128211804.1 | HK97 gp10 family phage protein | - |
| M1B70_RS03985 (M1B70_03985) | - | 788325..788699 (+) | 375 | WP_159215557.1 | DUF806 family protein | - |
| M1B70_RS03990 (M1B70_03990) | - | 788712..789314 (+) | 603 | WP_159215558.1 | phage tail protein | - |
| M1B70_RS03995 (M1B70_03995) | - | 789451..789855 (+) | 405 | WP_128211654.1 | phage tail tube assembly chaperone | - |
| M1B70_RS04000 (M1B70_04000) | - | 789888..790058 (+) | 171 | WP_164873654.1 | hypothetical protein | - |
| M1B70_RS04005 (M1B70_04005) | - | 790062..795176 (+) | 5115 | WP_128211656.1 | tape measure protein | - |
| M1B70_RS04010 (M1B70_04010) | - | 795189..796022 (+) | 834 | WP_128211658.1 | phage tail domain-containing protein | - |
| M1B70_RS04015 (M1B70_04015) | - | 796081..797166 (+) | 1086 | WP_159215560.1 | phage tail protein | - |
| M1B70_RS04020 (M1B70_04020) | - | 797156..797476 (+) | 321 | WP_128211663.1 | hypothetical protein | - |
| M1B70_RS04025 (M1B70_04025) | - | 797477..797788 (+) | 312 | WP_128211665.1 | hypothetical protein | - |
| M1B70_RS04030 (M1B70_04030) | - | 797788..799521 (+) | 1734 | WP_159215561.1 | BppU family phage baseplate upper protein | - |
| M1B70_RS04035 (M1B70_04035) | - | 799514..800473 (+) | 960 | WP_128211669.1 | hypothetical protein | - |
| M1B70_RS04040 (M1B70_04040) | - | 800473..800751 (+) | 279 | WP_128211671.1 | hypothetical protein | - |
| M1B70_RS04045 (M1B70_04045) | - | 800751..800897 (+) | 147 | WP_075139822.1 | XkdX family protein | - |
| M1B70_RS04050 (M1B70_04050) | - | 801004..801231 (+) | 228 | WP_235020341.1 | hypothetical protein | - |
| M1B70_RS04055 (M1B70_04055) | - | 801231..801473 (+) | 243 | WP_128211673.1 | phage holin | - |
| M1B70_RS04060 (M1B70_04060) | - | 801457..802578 (+) | 1122 | WP_128211675.1 | peptidoglycan recognition family protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15657.41 Da Isoelectric Point: 7.9971
>NTDB_id=681798 M1B70_RS03850 WP_128211868.1 772901..773326(+) (ssb) [Pediococcus acidilactici strain BB2-4M]
MINRTVLIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTQKGSLVGIDGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDLFANGGQSIDISDDQLPF
MINRTVLIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTQKGSLVGIDGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDLFANGGQSIDISDDQLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=681798 M1B70_RS03850 WP_128211868.1 772901..773326(+) (ssb) [Pediococcus acidilactici strain BB2-4M]
ATGATTAATCGAACAGTCCTAATAGGACGCCTAACTAAAGATGTTGAACTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGCGAAGCGGATTTCATCAACTGTGTAATGT
GGCGTAAGGCAGCAGAAAACTTTGCCAAGTACACACAAAAAGGTTCGTTGGTAGGCATTGACGGTCGAATTCAAACCCGT
TCGTACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCGTTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAATGCACGGCAAGCATCAACGCCGGGAGATCTGTTCGCCAATGGTGGTCAATCAATCGACA
TTTCAGATGATCAGCTCCCCTTTTAG
ATGATTAATCGAACAGTCCTAATAGGACGCCTAACTAAAGATGTTGAACTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGCGAAGCGGATTTCATCAACTGTGTAATGT
GGCGTAAGGCAGCAGAAAACTTTGCCAAGTACACACAAAAAGGTTCGTTGGTAGGCATTGACGGTCGAATTCAAACCCGT
TCGTACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCGTTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAATGCACGGCAAGCATCAACGCCGGGAGATCTGTTCGCCAATGGTGGTCAATCAATCGACA
TTTCAGATGATCAGCTCCCCTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.824 |
100 |
0.709 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
62.037 |
76.596 |
0.475 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.662 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.958 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.958 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.254 |
100 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
39.007 |
100 |
0.39 |