Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | M1F45_RS04475 | Genome accession | NZ_CP096540 |
| Coordinates | 907867..908295 (+) | Length | 142 a.a. |
| NCBI ID | WP_000934783.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain RIVM_M044329 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 898299..949102 | 907867..908295 | within | 0 |
Gene organization within MGE regions
Location: 898299..949102
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1F45_RS04395 (M1F45_04385) | rnr | 898299..900671 (+) | 2373 | WP_001050055.1 | ribonuclease R | - |
| M1F45_RS04400 (M1F45_04390) | smpB | 900693..901157 (+) | 465 | WP_001085185.1 | SsrA-binding protein SmpB | - |
| M1F45_RS04410 (M1F45_04400) | - | 901669..902718 (-) | 1050 | WP_021285879.1 | site-specific integrase | - |
| M1F45_RS04415 (M1F45_04405) | - | 902780..903295 (-) | 516 | WP_021285878.1 | hypothetical protein | - |
| M1F45_RS04420 (M1F45_04410) | - | 903299..903790 (-) | 492 | WP_001573838.1 | hypothetical protein | - |
| M1F45_RS04425 (M1F45_04415) | - | 903811..904269 (-) | 459 | WP_000521395.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M1F45_RS04430 (M1F45_04420) | - | 904291..904617 (-) | 327 | WP_000455972.1 | helix-turn-helix transcriptional regulator | - |
| M1F45_RS04435 (M1F45_04425) | - | 904780..904989 (+) | 210 | WP_001114715.1 | helix-turn-helix transcriptional regulator | - |
| M1F45_RS04440 (M1F45_04430) | - | 905028..905753 (+) | 726 | WP_015978381.1 | phage repressor protein | - |
| M1F45_RS04445 (M1F45_04435) | - | 905778..905987 (+) | 210 | WP_000455728.1 | hypothetical protein | - |
| M1F45_RS04450 (M1F45_04440) | - | 906000..906161 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| M1F45_RS04455 (M1F45_04445) | - | 906253..906513 (+) | 261 | WP_000291075.1 | DUF1108 family protein | - |
| M1F45_RS04460 (M1F45_04450) | - | 906521..906757 (+) | 237 | WP_000802315.1 | hypothetical protein | - |
| M1F45_RS04465 (M1F45_04455) | - | 906750..907229 (+) | 480 | WP_000002513.1 | siphovirus Gp157 family protein | - |
| M1F45_RS04470 (M1F45_04460) | - | 907229..907867 (+) | 639 | WP_021285877.1 | ERF family protein | - |
| M1F45_RS04475 (M1F45_04465) | ssbA | 907867..908295 (+) | 429 | WP_000934783.1 | single-stranded DNA-binding protein | Machinery gene |
| M1F45_RS04480 (M1F45_04470) | - | 908309..908983 (+) | 675 | WP_021285876.1 | putative HNHc nuclease | - |
| M1F45_RS04485 (M1F45_04475) | - | 908976..909731 (+) | 756 | WP_001037657.1 | DnaD domain protein | - |
| M1F45_RS04490 (M1F45_04480) | - | 909731..910087 (+) | 357 | WP_001132243.1 | hypothetical protein | - |
| M1F45_RS04495 (M1F45_04485) | - | 910084..911325 (+) | 1242 | WP_001106166.1 | DnaB helicase C-terminal domain-containing protein | - |
| M1F45_RS04500 (M1F45_04490) | - | 911322..911537 (+) | 216 | WP_021285875.1 | hypothetical protein | - |
| M1F45_RS04505 (M1F45_04495) | - | 911540..911761 (+) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| M1F45_RS04510 (M1F45_04500) | - | 911771..912178 (+) | 408 | WP_021285874.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M1F45_RS04515 (M1F45_04505) | - | 912178..912363 (+) | 186 | WP_021285873.1 | DUF3113 family protein | - |
| M1F45_RS04520 (M1F45_04510) | - | 912364..912981 (+) | 618 | WP_021285872.1 | SA1788 family PVL leukocidin-associated protein | - |
| M1F45_RS04525 (M1F45_04515) | - | 912981..913235 (+) | 255 | WP_021285871.1 | DUF3310 domain-containing protein | - |
| M1F45_RS04530 (M1F45_04520) | - | 913235..913483 (+) | 249 | WP_078069534.1 | SAV1978 family virulence-associated passenger protein | - |
| M1F45_RS04535 (M1F45_04525) | - | 913498..913704 (+) | 207 | WP_021285869.1 | hypothetical protein | - |
| M1F45_RS04540 (M1F45_04530) | - | 913707..914114 (+) | 408 | WP_000695770.1 | hypothetical protein | - |
| M1F45_RS04545 (M1F45_04535) | - | 914111..914458 (+) | 348 | WP_000979209.1 | YopX family protein | - |
| M1F45_RS04550 (M1F45_04540) | - | 914455..914763 (+) | 309 | WP_000144708.1 | hypothetical protein | - |
| M1F45_RS04555 (M1F45_04545) | - | 914756..915007 (+) | 252 | WP_031267622.1 | DUF1024 family protein | - |
| M1F45_RS04560 (M1F45_04550) | - | 914997..915170 (+) | 174 | WP_000028424.1 | hypothetical protein | - |
| M1F45_RS04565 (M1F45_04555) | - | 915171..915332 (+) | 162 | WP_000889684.1 | hypothetical protein | - |
| M1F45_RS04570 (M1F45_04560) | - | 915347..915853 (+) | 507 | WP_001061842.1 | dUTPase | - |
| M1F45_RS04575 (M1F45_04565) | - | 915890..916096 (+) | 207 | WP_021285914.1 | DUF1381 domain-containing protein | - |
| M1F45_RS04580 (M1F45_04570) | - | 916093..916296 (+) | 204 | WP_000141180.1 | hypothetical protein | - |
| M1F45_RS04585 (M1F45_04575) | - | 916289..916525 (+) | 237 | WP_000608281.1 | hypothetical protein | - |
| M1F45_RS04590 (M1F45_04580) | - | 916515..916904 (+) | 390 | WP_169538641.1 | hypothetical protein | - |
| M1F45_RS04595 (M1F45_04585) | - | 916901..917074 (+) | 174 | WP_000595258.1 | transcriptional activator RinB | - |
| M1F45_RS04600 (M1F45_04590) | - | 917075..917476 (+) | 402 | WP_000286968.1 | hypothetical protein | - |
| M1F45_RS04605 (M1F45_04595) | - | 917824..918204 (+) | 381 | WP_031838201.1 | DNA-binding protein | - |
| M1F45_RS04610 (M1F45_04600) | - | 918188..919453 (+) | 1266 | WP_031838202.1 | PBSX family phage terminase large subunit | - |
| M1F45_RS04615 (M1F45_04605) | - | 919472..920878 (+) | 1407 | WP_031886702.1 | phage portal protein | - |
| M1F45_RS04620 (M1F45_04610) | - | 920817..921797 (+) | 981 | WP_049949321.1 | phage head morphogenesis protein | - |
| M1F45_RS04625 (M1F45_04615) | - | 921895..922491 (+) | 597 | WP_015967248.1 | phage scaffolding protein | - |
| M1F45_RS04630 (M1F45_04620) | - | 922512..923336 (+) | 825 | WP_031838205.1 | N4-gp56 family major capsid protein | - |
| M1F45_RS04635 (M1F45_04625) | - | 923353..923679 (+) | 327 | WP_031838206.1 | Rho termination factor N-terminal domain-containing protein | - |
| M1F45_RS04640 (M1F45_04630) | - | 923679..923993 (+) | 315 | WP_031838207.1 | phage head-tail connector protein | - |
| M1F45_RS04645 (M1F45_04635) | - | 923986..924321 (+) | 336 | WP_031838208.1 | phage head closure protein | - |
| M1F45_RS04650 (M1F45_04640) | - | 924308..924721 (+) | 414 | WP_031838209.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| M1F45_RS04655 (M1F45_04645) | - | 924734..925171 (+) | 438 | WP_031838210.1 | DUF3168 domain-containing protein | - |
| M1F45_RS04660 (M1F45_04650) | - | 925158..925718 (+) | 561 | WP_000046067.1 | hypothetical protein | - |
| M1F45_RS04665 (M1F45_04655) | - | 925780..926274 (+) | 495 | WP_000141084.1 | tail assembly chaperone | - |
| M1F45_RS04670 (M1F45_04660) | - | 926295..926636 (+) | 342 | WP_049949322.1 | hypothetical protein | - |
| M1F45_RS04675 (M1F45_04665) | - | 926639..929608 (+) | 2970 | WP_031838212.1 | terminase | - |
| M1F45_RS04680 (M1F45_04670) | - | 929623..930558 (+) | 936 | WP_031838213.1 | phage tail domain-containing protein | - |
| M1F45_RS04685 (M1F45_04675) | - | 930569..932455 (+) | 1887 | WP_031903449.1 | SGNH/GDSL hydrolase family protein | - |
| M1F45_RS04690 (M1F45_04680) | - | 932468..934366 (+) | 1899 | WP_031838215.1 | hypothetical protein | - |
| M1F45_RS04695 (M1F45_04685) | - | 934366..936189 (+) | 1824 | WP_031838216.1 | BppU family phage baseplate upper protein | - |
| M1F45_RS04700 (M1F45_04690) | - | 936189..936566 (+) | 378 | WP_031838217.1 | DUF2977 domain-containing protein | - |
| M1F45_RS04705 (M1F45_04695) | - | 936570..936743 (+) | 174 | WP_078098837.1 | XkdX family protein | - |
| M1F45_RS04710 (M1F45_04700) | - | 936782..937216 (+) | 435 | WP_031903468.1 | hypothetical protein | - |
| M1F45_RS04715 (M1F45_04705) | - | 937200..937595 (+) | 396 | WP_031838220.1 | hypothetical protein | - |
| M1F45_RS04720 (M1F45_04710) | - | 937648..939522 (+) | 1875 | WP_031886698.1 | glucosaminidase domain-containing protein | - |
| M1F45_RS04725 (M1F45_04715) | - | 939535..940113 (+) | 579 | Protein_921 | phage baseplate upper protein | - |
| M1F45_RS04730 (M1F45_04720) | - | 941410..942129 (+) | 720 | WP_223877258.1 | SGNH/GDSL hydrolase family protein | - |
| M1F45_RS04735 (M1F45_04725) | - | 942185..942622 (+) | 438 | WP_021285832.1 | phage holin | - |
| M1F45_RS04740 (M1F45_04730) | - | 942603..944048 (+) | 1446 | WP_021285831.1 | SH3 domain-containing protein | - |
| M1F45_RS04745 (M1F45_04735) | - | 944653..944847 (+) | 195 | WP_021285829.1 | hypothetical protein | - |
| M1F45_RS04750 (M1F45_04740) | - | 944862..945062 (+) | 201 | WP_021285828.1 | hypothetical protein | - |
| M1F45_RS04755 (M1F45_04745) | - | 945599..946144 (+) | 546 | WP_000280154.1 | hypothetical protein | - |
| M1F45_RS04760 (M1F45_04750) | - | 946575..947303 (-) | 729 | WP_000757407.1 | DUF5067 domain-containing protein | - |
| M1F45_RS04765 (M1F45_04755) | - | 947749..947904 (+) | 156 | WP_014937001.1 | hypothetical protein | - |
| M1F45_RS04770 (M1F45_04760) | - | 947912..948433 (+) | 522 | WP_000608190.1 | hypothetical protein | - |
| M1F45_RS04775 (M1F45_04765) | - | 948572..949102 (+) | 531 | WP_001167164.1 | N-acetyltransferase | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16047.61 Da Isoelectric Point: 5.8724
>NTDB_id=681723 M1F45_RS04475 WP_000934783.1 907867..908295(+) (ssbA) [Staphylococcus aureus strain RIVM_M044329]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAIIDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAIIDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=681723 M1F45_RS04475 WP_000934783.1 907867..908295(+) (ssbA) [Staphylococcus aureus strain RIVM_M044329]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTATTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTATTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.657 |
100 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
46.957 |
80.986 |
0.38 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.763 |
83.099 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.763 |
83.099 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.915 |
83.099 |
0.373 |