Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | MXM90_RS10875 | Genome accession | NZ_CP095737 |
| Coordinates | 2147256..2147525 (-) | Length | 89 a.a. |
| NCBI ID | WP_003129998.1 | Uniprot ID | - |
| Organism | Lactococcus lactis strain JNU 534 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2134569..2189019 | 2147256..2147525 | within | 0 |
Gene organization within MGE regions
Location: 2134569..2189019
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MXM90_RS10800 (MXM90_10800) | - | 2134569..2136386 (-) | 1818 | WP_058225728.1 | acyltransferase family protein | - |
| MXM90_RS10805 (MXM90_10805) | - | 2136488..2138719 (-) | 2232 | WP_003129980.1 | PBP1A family penicillin-binding protein | - |
| MXM90_RS10810 (MXM90_10810) | - | 2139028..2139663 (-) | 636 | WP_012898614.1 | DUF421 domain-containing protein | - |
| MXM90_RS10815 (MXM90_10815) | - | 2139680..2140111 (-) | 432 | WP_010906308.1 | DUF3290 domain-containing protein | - |
| MXM90_RS10820 (MXM90_10820) | - | 2140225..2140602 (-) | 378 | WP_003129983.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| MXM90_RS10825 (MXM90_10825) | - | 2140806..2141672 (+) | 867 | WP_003129984.1 | RluA family pseudouridine synthase | - |
| MXM90_RS10830 (MXM90_10830) | - | 2141711..2142520 (-) | 810 | WP_014570791.1 | metal ABC transporter permease | - |
| MXM90_RS10835 (MXM90_10835) | - | 2142513..2143250 (-) | 738 | WP_058221575.1 | metal ABC transporter ATP-binding protein | - |
| MXM90_RS10840 (MXM90_10840) | - | 2143427..2144269 (-) | 843 | WP_003129990.1 | metal ABC transporter substrate-binding protein | - |
| MXM90_RS10845 (MXM90_10845) | - | 2144266..2144703 (-) | 438 | WP_003129992.1 | zinc-dependent MarR family transcriptional regulator | - |
| MXM90_RS10850 (MXM90_10850) | - | 2144902..2145849 (+) | 948 | WP_081196255.1 | IS30 family transposase | - |
| MXM90_RS10855 (MXM90_10855) | comGG | 2145823..2146149 (-) | 327 | WP_058221568.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| MXM90_RS10860 (MXM90_10860) | comGF | 2146188..2146634 (-) | 447 | WP_058225890.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| MXM90_RS10865 (MXM90_10865) | comGE | 2146597..2146893 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| MXM90_RS10870 (MXM90_10870) | comGD | 2146865..2147296 (-) | 432 | WP_080585155.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| MXM90_RS10875 (MXM90_10875) | comGC | 2147256..2147525 (-) | 270 | WP_003129998.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| MXM90_RS10885 (MXM90_10885) | - | 2148306..2148767 (-) | 462 | WP_003132936.1 | hypothetical protein | - |
| MXM90_RS10890 (MXM90_10890) | - | 2148770..2149378 (-) | 609 | WP_003132937.1 | hypothetical protein | - |
| MXM90_RS10895 (MXM90_10895) | - | 2149391..2150140 (-) | 750 | WP_003132938.1 | hypothetical protein | - |
| MXM90_RS10900 (MXM90_10900) | - | 2150414..2151703 (-) | 1290 | WP_153928112.1 | LysM peptidoglycan-binding domain-containing protein | - |
| MXM90_RS10905 (MXM90_10905) | - | 2151700..2151966 (-) | 267 | WP_015966839.1 | phage holin | - |
| MXM90_RS10910 (MXM90_10910) | - | 2151978..2152205 (-) | 228 | WP_058221378.1 | hemolysin XhlA family protein | - |
| MXM90_RS10915 (MXM90_10915) | - | 2152335..2154353 (-) | 2019 | WP_247348426.1 | phage baseplate upper protein | - |
| MXM90_RS10920 (MXM90_10920) | - | 2154366..2157113 (-) | 2748 | WP_247348429.1 | phage tail spike protein | - |
| MXM90_RS10925 (MXM90_10925) | - | 2157110..2157859 (-) | 750 | WP_141347768.1 | phage tail protein | - |
| MXM90_RS10930 (MXM90_10930) | - | 2157860..2160121 (-) | 2262 | WP_141347769.1 | phage tail tape measure protein | - |
| MXM90_RS10935 (MXM90_10935) | - | 2160338..2160697 (-) | 360 | WP_010905721.1 | hypothetical protein | - |
| MXM90_RS10940 (MXM90_10940) | - | 2160707..2161315 (-) | 609 | WP_141347770.1 | major tail protein | - |
| MXM90_RS10945 (MXM90_10945) | - | 2161333..2161650 (-) | 318 | WP_010905719.1 | hypothetical protein | - |
| MXM90_RS10950 (MXM90_10950) | - | 2161647..2162018 (-) | 372 | WP_010905718.1 | HK97 gp10 family phage protein | - |
| MXM90_RS10955 (MXM90_10955) | - | 2162008..2162325 (-) | 318 | WP_010905717.1 | phage head closure protein | - |
| MXM90_RS10960 (MXM90_10960) | - | 2162312..2162593 (-) | 282 | WP_141347771.1 | hypothetical protein | - |
| MXM90_RS10965 (MXM90_10965) | - | 2162586..2163443 (-) | 858 | WP_141347772.1 | hypothetical protein | - |
| MXM90_RS10970 (MXM90_10970) | - | 2163498..2164691 (-) | 1194 | WP_141347773.1 | phage major capsid protein | - |
| MXM90_RS10975 (MXM90_10975) | - | 2164663..2165259 (-) | 597 | WP_141347774.1 | HK97 family phage prohead protease | - |
| MXM90_RS10980 (MXM90_10980) | - | 2165274..2166479 (-) | 1206 | WP_010905712.1 | phage portal protein | - |
| MXM90_RS10985 (MXM90_10985) | - | 2166493..2168271 (-) | 1779 | WP_101913533.1 | terminase large subunit | - |
| MXM90_RS10990 (MXM90_10990) | - | 2168255..2168623 (-) | 369 | WP_010905710.1 | P27 family phage terminase small subunit | - |
| MXM90_RS10995 (MXM90_10995) | - | 2168715..2169014 (-) | 300 | WP_141347775.1 | HNH endonuclease | - |
| MXM90_RS11000 (MXM90_11000) | - | 2169064..2169264 (-) | 201 | WP_141347776.1 | hypothetical protein | - |
| MXM90_RS11005 (MXM90_11005) | - | 2169612..2170034 (-) | 423 | WP_032398555.1 | RinA family protein | - |
| MXM90_RS11010 (MXM90_11010) | - | 2170559..2170714 (-) | 156 | WP_043991164.1 | hypothetical protein | - |
| MXM90_RS11015 (MXM90_11015) | - | 2170711..2170896 (-) | 186 | WP_014570738.1 | hypothetical protein | - |
| MXM90_RS11020 (MXM90_11020) | - | 2170904..2171107 (-) | 204 | WP_014570739.1 | hypothetical protein | - |
| MXM90_RS11025 (MXM90_11025) | - | 2171230..2171406 (-) | 177 | WP_043991165.1 | DUF1660 domain-containing protein | - |
| MXM90_RS11030 (MXM90_11030) | - | 2171403..2171546 (-) | 144 | WP_010905362.1 | hypothetical protein | - |
| MXM90_RS11035 (MXM90_11035) | - | 2171624..2172304 (-) | 681 | WP_247348432.1 | hypothetical protein | - |
| MXM90_RS11040 (MXM90_11040) | - | 2172331..2172603 (-) | 273 | WP_014570742.1 | hypothetical protein | - |
| MXM90_RS11045 (MXM90_11045) | - | 2172607..2172828 (-) | 222 | Protein_2158 | aminotransferase | - |
| MXM90_RS11050 (MXM90_11050) | - | 2173062..2173472 (-) | 411 | WP_014570810.1 | hypothetical protein | - |
| MXM90_RS11055 (MXM90_11055) | - | 2173485..2173727 (-) | 243 | WP_023349173.1 | L-rhamnose isomerase | - |
| MXM90_RS11060 (MXM90_11060) | - | 2173720..2174643 (-) | 924 | WP_023349174.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MXM90_RS11070 (MXM90_11070) | - | 2174917..2175843 (-) | 927 | WP_141347740.1 | RecT family recombinase | - |
| MXM90_RS11075 (MXM90_11075) | - | 2175840..2176673 (-) | 834 | WP_141347741.1 | hypothetical protein | - |
| MXM90_RS11080 (MXM90_11080) | - | 2176779..2176955 (-) | 177 | WP_014570529.1 | putative transcriptional regulator | - |
| MXM90_RS11085 (MXM90_11085) | - | 2176952..2177200 (-) | 249 | WP_012897635.1 | hypothetical protein | - |
| MXM90_RS12805 | - | 2177213..2177335 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| MXM90_RS11090 (MXM90_11090) | - | 2177332..2177514 (-) | 183 | WP_003130605.1 | hypothetical protein | - |
| MXM90_RS11095 (MXM90_11095) | - | 2177530..2178219 (-) | 690 | WP_141347742.1 | Rha family transcriptional regulator | - |
| MXM90_RS11100 (MXM90_11100) | - | 2178278..2178511 (-) | 234 | WP_014570819.1 | transcriptional regulator | - |
| MXM90_RS11105 (MXM90_11105) | - | 2178688..2179095 (+) | 408 | WP_023189013.1 | helix-turn-helix transcriptional regulator | - |
| MXM90_RS11110 (MXM90_11110) | - | 2179106..2179690 (+) | 585 | WP_095345732.1 | hypothetical protein | - |
| MXM90_RS11115 (MXM90_11115) | - | 2179745..2180284 (+) | 540 | WP_023164651.1 | PH domain-containing protein | - |
| MXM90_RS11120 (MXM90_11120) | - | 2180409..2181866 (+) | 1458 | WP_058221720.1 | recombinase family protein | - |
| MXM90_RS11125 (MXM90_11125) | - | 2181863..2182003 (-) | 141 | WP_023164653.1 | hypothetical protein | - |
| MXM90_RS11130 (MXM90_11130) | comGB | 2182017..2183090 (-) | 1074 | WP_014570824.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| MXM90_RS11135 (MXM90_11135) | comGA | 2182984..2183923 (-) | 940 | Protein_2176 | competence type IV pilus ATPase ComGA | - |
| MXM90_RS11140 (MXM90_11140) | - | 2184043..2188959 (-) | 4917 | WP_058221721.1 | PolC-type DNA polymerase III | - |
Sequence
Protein
Download Length: 89 a.a. Molecular weight: 10123.56 Da Isoelectric Point: 4.2950
>NTDB_id=677942 MXM90_RS10875 WP_003129998.1 2147256..2147525(-) (comGC) [Lactococcus lactis strain JNU 534]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND
Nucleotide
Download Length: 270 bp
>NTDB_id=677942 MXM90_RS10875 WP_003129998.1 2147256..2147525(-) (comGC) [Lactococcus lactis strain JNU 534]
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Lactococcus lactis subsp. cremoris KW2 |
86.667 |
84.27 |
0.73 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae D39 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae R6 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
55.056 |
100 |
0.551 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.471 |
95.506 |
0.539 |
| comYC | Streptococcus suis isolate S10 |
58.904 |
82.022 |
0.483 |
| comGC/cglC | Streptococcus mitis SK321 |
53.947 |
85.393 |
0.461 |
| comYC | Streptococcus mutans UA140 |
50.685 |
82.022 |
0.416 |
| comYC | Streptococcus mutans UA159 |
50.685 |
82.022 |
0.416 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
56.25 |
71.91 |
0.404 |