Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   MXM90_RS10855 Genome accession   NZ_CP095737
Coordinates   2145823..2146149 (-) Length   108 a.a.
NCBI ID   WP_058221568.1    Uniprot ID   -
Organism   Lactococcus lactis strain JNU 534     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2134569..2189019 2145823..2146149 within 0


Gene organization within MGE regions


Location: 2134569..2189019
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MXM90_RS10800 (MXM90_10800) - 2134569..2136386 (-) 1818 WP_058225728.1 acyltransferase family protein -
  MXM90_RS10805 (MXM90_10805) - 2136488..2138719 (-) 2232 WP_003129980.1 PBP1A family penicillin-binding protein -
  MXM90_RS10810 (MXM90_10810) - 2139028..2139663 (-) 636 WP_012898614.1 DUF421 domain-containing protein -
  MXM90_RS10815 (MXM90_10815) - 2139680..2140111 (-) 432 WP_010906308.1 DUF3290 domain-containing protein -
  MXM90_RS10820 (MXM90_10820) - 2140225..2140602 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  MXM90_RS10825 (MXM90_10825) - 2140806..2141672 (+) 867 WP_003129984.1 RluA family pseudouridine synthase -
  MXM90_RS10830 (MXM90_10830) - 2141711..2142520 (-) 810 WP_014570791.1 metal ABC transporter permease -
  MXM90_RS10835 (MXM90_10835) - 2142513..2143250 (-) 738 WP_058221575.1 metal ABC transporter ATP-binding protein -
  MXM90_RS10840 (MXM90_10840) - 2143427..2144269 (-) 843 WP_003129990.1 metal ABC transporter substrate-binding protein -
  MXM90_RS10845 (MXM90_10845) - 2144266..2144703 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  MXM90_RS10850 (MXM90_10850) - 2144902..2145849 (+) 948 WP_081196255.1 IS30 family transposase -
  MXM90_RS10855 (MXM90_10855) comGG 2145823..2146149 (-) 327 WP_058221568.1 competence type IV pilus minor pilin ComGG Machinery gene
  MXM90_RS10860 (MXM90_10860) comGF 2146188..2146634 (-) 447 WP_058225890.1 competence type IV pilus minor pilin ComGF Machinery gene
  MXM90_RS10865 (MXM90_10865) comGE 2146597..2146893 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  MXM90_RS10870 (MXM90_10870) comGD 2146865..2147296 (-) 432 WP_080585155.1 competence type IV pilus minor pilin ComGD Machinery gene
  MXM90_RS10875 (MXM90_10875) comGC 2147256..2147525 (-) 270 WP_003129998.1 competence type IV pilus major pilin ComGC Machinery gene
  MXM90_RS10885 (MXM90_10885) - 2148306..2148767 (-) 462 WP_003132936.1 hypothetical protein -
  MXM90_RS10890 (MXM90_10890) - 2148770..2149378 (-) 609 WP_003132937.1 hypothetical protein -
  MXM90_RS10895 (MXM90_10895) - 2149391..2150140 (-) 750 WP_003132938.1 hypothetical protein -
  MXM90_RS10900 (MXM90_10900) - 2150414..2151703 (-) 1290 WP_153928112.1 LysM peptidoglycan-binding domain-containing protein -
  MXM90_RS10905 (MXM90_10905) - 2151700..2151966 (-) 267 WP_015966839.1 phage holin -
  MXM90_RS10910 (MXM90_10910) - 2151978..2152205 (-) 228 WP_058221378.1 hemolysin XhlA family protein -
  MXM90_RS10915 (MXM90_10915) - 2152335..2154353 (-) 2019 WP_247348426.1 phage baseplate upper protein -
  MXM90_RS10920 (MXM90_10920) - 2154366..2157113 (-) 2748 WP_247348429.1 phage tail spike protein -
  MXM90_RS10925 (MXM90_10925) - 2157110..2157859 (-) 750 WP_141347768.1 phage tail protein -
  MXM90_RS10930 (MXM90_10930) - 2157860..2160121 (-) 2262 WP_141347769.1 phage tail tape measure protein -
  MXM90_RS10935 (MXM90_10935) - 2160338..2160697 (-) 360 WP_010905721.1 hypothetical protein -
  MXM90_RS10940 (MXM90_10940) - 2160707..2161315 (-) 609 WP_141347770.1 major tail protein -
  MXM90_RS10945 (MXM90_10945) - 2161333..2161650 (-) 318 WP_010905719.1 hypothetical protein -
  MXM90_RS10950 (MXM90_10950) - 2161647..2162018 (-) 372 WP_010905718.1 HK97 gp10 family phage protein -
  MXM90_RS10955 (MXM90_10955) - 2162008..2162325 (-) 318 WP_010905717.1 phage head closure protein -
  MXM90_RS10960 (MXM90_10960) - 2162312..2162593 (-) 282 WP_141347771.1 hypothetical protein -
  MXM90_RS10965 (MXM90_10965) - 2162586..2163443 (-) 858 WP_141347772.1 hypothetical protein -
  MXM90_RS10970 (MXM90_10970) - 2163498..2164691 (-) 1194 WP_141347773.1 phage major capsid protein -
  MXM90_RS10975 (MXM90_10975) - 2164663..2165259 (-) 597 WP_141347774.1 HK97 family phage prohead protease -
  MXM90_RS10980 (MXM90_10980) - 2165274..2166479 (-) 1206 WP_010905712.1 phage portal protein -
  MXM90_RS10985 (MXM90_10985) - 2166493..2168271 (-) 1779 WP_101913533.1 terminase large subunit -
  MXM90_RS10990 (MXM90_10990) - 2168255..2168623 (-) 369 WP_010905710.1 P27 family phage terminase small subunit -
  MXM90_RS10995 (MXM90_10995) - 2168715..2169014 (-) 300 WP_141347775.1 HNH endonuclease -
  MXM90_RS11000 (MXM90_11000) - 2169064..2169264 (-) 201 WP_141347776.1 hypothetical protein -
  MXM90_RS11005 (MXM90_11005) - 2169612..2170034 (-) 423 WP_032398555.1 RinA family protein -
  MXM90_RS11010 (MXM90_11010) - 2170559..2170714 (-) 156 WP_043991164.1 hypothetical protein -
  MXM90_RS11015 (MXM90_11015) - 2170711..2170896 (-) 186 WP_014570738.1 hypothetical protein -
  MXM90_RS11020 (MXM90_11020) - 2170904..2171107 (-) 204 WP_014570739.1 hypothetical protein -
  MXM90_RS11025 (MXM90_11025) - 2171230..2171406 (-) 177 WP_043991165.1 DUF1660 domain-containing protein -
  MXM90_RS11030 (MXM90_11030) - 2171403..2171546 (-) 144 WP_010905362.1 hypothetical protein -
  MXM90_RS11035 (MXM90_11035) - 2171624..2172304 (-) 681 WP_247348432.1 hypothetical protein -
  MXM90_RS11040 (MXM90_11040) - 2172331..2172603 (-) 273 WP_014570742.1 hypothetical protein -
  MXM90_RS11045 (MXM90_11045) - 2172607..2172828 (-) 222 Protein_2158 aminotransferase -
  MXM90_RS11050 (MXM90_11050) - 2173062..2173472 (-) 411 WP_014570810.1 hypothetical protein -
  MXM90_RS11055 (MXM90_11055) - 2173485..2173727 (-) 243 WP_023349173.1 L-rhamnose isomerase -
  MXM90_RS11060 (MXM90_11060) - 2173720..2174643 (-) 924 WP_023349174.1 phage replisome organizer N-terminal domain-containing protein -
  MXM90_RS11070 (MXM90_11070) - 2174917..2175843 (-) 927 WP_141347740.1 RecT family recombinase -
  MXM90_RS11075 (MXM90_11075) - 2175840..2176673 (-) 834 WP_141347741.1 hypothetical protein -
  MXM90_RS11080 (MXM90_11080) - 2176779..2176955 (-) 177 WP_014570529.1 putative transcriptional regulator -
  MXM90_RS11085 (MXM90_11085) - 2176952..2177200 (-) 249 WP_012897635.1 hypothetical protein -
  MXM90_RS12805 - 2177213..2177335 (-) 123 WP_023164646.1 hypothetical protein -
  MXM90_RS11090 (MXM90_11090) - 2177332..2177514 (-) 183 WP_003130605.1 hypothetical protein -
  MXM90_RS11095 (MXM90_11095) - 2177530..2178219 (-) 690 WP_141347742.1 Rha family transcriptional regulator -
  MXM90_RS11100 (MXM90_11100) - 2178278..2178511 (-) 234 WP_014570819.1 transcriptional regulator -
  MXM90_RS11105 (MXM90_11105) - 2178688..2179095 (+) 408 WP_023189013.1 helix-turn-helix transcriptional regulator -
  MXM90_RS11110 (MXM90_11110) - 2179106..2179690 (+) 585 WP_095345732.1 hypothetical protein -
  MXM90_RS11115 (MXM90_11115) - 2179745..2180284 (+) 540 WP_023164651.1 PH domain-containing protein -
  MXM90_RS11120 (MXM90_11120) - 2180409..2181866 (+) 1458 WP_058221720.1 recombinase family protein -
  MXM90_RS11125 (MXM90_11125) - 2181863..2182003 (-) 141 WP_023164653.1 hypothetical protein -
  MXM90_RS11130 (MXM90_11130) comGB 2182017..2183090 (-) 1074 WP_014570824.1 competence type IV pilus assembly protein ComGB Machinery gene
  MXM90_RS11135 (MXM90_11135) comGA 2182984..2183923 (-) 940 Protein_2176 competence type IV pilus ATPase ComGA -
  MXM90_RS11140 (MXM90_11140) - 2184043..2188959 (-) 4917 WP_058221721.1 PolC-type DNA polymerase III -

Sequence

Protein


Download         Length: 108 a.a.        Molecular weight: 12234.69 Da        Isoelectric Point: 6.0669

>NTDB_id=677938 MXM90_RS10855 WP_058221568.1 2145823..2146149(-) (comGG) [Lactococcus lactis strain JNU 534]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKNANCKSKLASQAHLI

Nucleotide


Download         Length: 327 bp        

>NTDB_id=677938 MXM90_RS10855 WP_058221568.1 2145823..2146149(-) (comGG) [Lactococcus lactis strain JNU 534]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAACGCAAATTGCAAGTCCAAGTTAGCCAGCCAAGCTCATCT
CATATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.065

86.111

0.5