Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MU539_RS03810 | Genome accession | NZ_CP095384 |
| Coordinates | 787364..787801 (+) | Length | 145 a.a. |
| NCBI ID | WP_257586235.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus rhamnosus strain VHProbi M14 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 779892..818897 | 787364..787801 | within | 0 |
Gene organization within MGE regions
Location: 779892..818897
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MU539_RS03740 (MU539_03730) | - | 779892..781019 (-) | 1128 | WP_257586224.1 | site-specific integrase | - |
| MU539_RS03745 (MU539_03735) | - | 781183..782028 (-) | 846 | WP_257586225.1 | SHOCT domain-containing protein | - |
| MU539_RS03750 (MU539_03740) | - | 782088..782861 (-) | 774 | WP_257586227.1 | XRE family transcriptional regulator | - |
| MU539_RS03755 (MU539_03745) | - | 783019..783270 (+) | 252 | WP_005714763.1 | helix-turn-helix transcriptional regulator | - |
| MU539_RS03760 (MU539_03750) | - | 783267..783482 (+) | 216 | WP_064520385.1 | BRO family protein | - |
| MU539_RS03765 (MU539_03755) | - | 783507..784250 (+) | 744 | WP_064521148.1 | phage antirepressor KilAC domain-containing protein | - |
| MU539_RS03770 (MU539_03760) | - | 784247..784396 (+) | 150 | WP_005712705.1 | hypothetical protein | - |
| MU539_RS03775 (MU539_03765) | - | 784393..784593 (-) | 201 | WP_003564805.1 | hypothetical protein | - |
| MU539_RS03780 (MU539_03770) | - | 784668..785024 (+) | 357 | WP_257586230.1 | DUF771 domain-containing protein | - |
| MU539_RS03785 (MU539_03775) | - | 785109..785261 (+) | 153 | WP_164883155.1 | hypothetical protein | - |
| MU539_RS03790 (MU539_03780) | - | 785266..785469 (+) | 204 | WP_257586231.1 | hypothetical protein | - |
| MU539_RS03795 (MU539_03785) | - | 785487..785978 (+) | 492 | WP_061713682.1 | siphovirus Gp157 family protein | - |
| MU539_RS03800 (MU539_03790) | - | 785990..786706 (+) | 717 | WP_257586233.1 | ERF family protein | - |
| MU539_RS03805 (MU539_03795) | - | 786681..787349 (+) | 669 | WP_257586234.1 | putative HNHc nuclease | - |
| MU539_RS03810 (MU539_03800) | ssb | 787364..787801 (+) | 438 | WP_257586235.1 | single-stranded DNA-binding protein | Machinery gene |
| MU539_RS03815 (MU539_03805) | - | 787818..788645 (+) | 828 | WP_257586236.1 | helix-turn-helix domain-containing protein | - |
| MU539_RS03820 (MU539_03810) | - | 788642..789904 (+) | 1263 | WP_257586237.1 | DnaB helicase C-terminal domain-containing protein | - |
| MU539_RS03825 (MU539_03815) | - | 789906..790250 (+) | 345 | WP_070792325.1 | hypothetical protein | - |
| MU539_RS03830 (MU539_03820) | - | 790263..790550 (+) | 288 | WP_070792327.1 | helix-turn-helix transcriptional regulator | - |
| MU539_RS03835 (MU539_03825) | - | 790537..790791 (+) | 255 | WP_257586239.1 | hypothetical protein | - |
| MU539_RS03840 (MU539_03830) | - | 790788..791153 (+) | 366 | WP_003607027.1 | endodeoxyribonuclease | - |
| MU539_RS03845 (MU539_03835) | - | 791166..791630 (+) | 465 | WP_015764333.1 | hypothetical protein | - |
| MU539_RS03850 (MU539_03840) | - | 791642..791827 (+) | 186 | WP_014569476.1 | hypothetical protein | - |
| MU539_RS03855 (MU539_03845) | - | 791824..792372 (+) | 549 | WP_047676133.1 | DUF1642 domain-containing protein | - |
| MU539_RS03860 (MU539_03850) | - | 792362..792538 (+) | 177 | WP_003582729.1 | hypothetical protein | - |
| MU539_RS03865 (MU539_03855) | - | 792593..792814 (+) | 222 | WP_005711376.1 | helix-turn-helix domain-containing protein | - |
| MU539_RS03870 (MU539_03860) | - | 793020..793448 (+) | 429 | WP_257586241.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MU539_RS03875 (MU539_03865) | - | 793732..794733 (+) | 1002 | WP_257586468.1 | hypothetical protein | - |
| MU539_RS03880 (MU539_03870) | - | 795266..796483 (+) | 1218 | WP_024129330.1 | GcrA family cell cycle regulator | - |
| MU539_RS03885 (MU539_03875) | - | 796470..797000 (+) | 531 | WP_021354318.1 | NUMOD4 motif-containing HNH endonuclease | - |
| MU539_RS13640 | - | 797004..797090 (+) | 87 | Protein_739 | ribonucleoside-diphosphate reductase | - |
| MU539_RS03890 (MU539_03880) | - | 797103..797420 (+) | 318 | WP_306808353.1 | hypothetical protein | - |
| MU539_RS03895 (MU539_03885) | - | 797432..797866 (+) | 435 | Protein_741 | hypothetical protein | - |
| MU539_RS03900 (MU539_03890) | - | 797894..798049 (+) | 156 | WP_257586519.1 | hypothetical protein | - |
| MU539_RS03905 (MU539_03895) | - | 798062..798550 (+) | 489 | WP_257586244.1 | HNH endonuclease | - |
| MU539_RS03910 (MU539_03900) | - | 798686..799159 (+) | 474 | WP_024129329.1 | phage terminase small subunit P27 family | - |
| MU539_RS03915 (MU539_03905) | - | 799156..801048 (+) | 1893 | WP_257586246.1 | terminase large subunit | - |
| MU539_RS03920 (MU539_03910) | - | 801035..801244 (+) | 210 | WP_080751823.1 | hypothetical protein | - |
| MU539_RS03925 (MU539_03915) | - | 801244..802431 (+) | 1188 | WP_039141544.1 | phage portal protein | - |
| MU539_RS03930 (MU539_03920) | - | 802409..803125 (+) | 717 | WP_257586247.1 | head maturation protease, ClpP-related | - |
| MU539_RS03935 (MU539_03925) | - | 803125..804366 (+) | 1242 | WP_257586248.1 | phage major capsid protein | - |
| MU539_RS03940 (MU539_03930) | - | 804438..804746 (+) | 309 | WP_257586249.1 | hypothetical protein | - |
| MU539_RS03945 (MU539_03935) | - | 804736..805080 (+) | 345 | WP_257586469.1 | phage head closure protein | - |
| MU539_RS03950 (MU539_03940) | - | 805083..805502 (+) | 420 | WP_024129324.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MU539_RS03955 (MU539_03945) | - | 805499..805870 (+) | 372 | WP_021354702.1 | DUF806 family protein | - |
| MU539_RS03960 (MU539_03950) | - | 805882..806517 (+) | 636 | WP_257586252.1 | phage tail protein | - |
| MU539_RS03965 (MU539_03955) | - | 806675..807025 (+) | 351 | WP_257586253.1 | phage tail assembly chaperone | - |
| MU539_RS03970 (MU539_03960) | - | 807003..807233 (+) | 231 | WP_057709200.1 | hypothetical protein | - |
| MU539_RS03975 (MU539_03965) | - | 807263..811339 (+) | 4077 | WP_257586254.1 | tape measure protein | - |
| MU539_RS03980 (MU539_03970) | - | 811340..813289 (+) | 1950 | WP_257586256.1 | distal tail protein Dit | - |
| MU539_RS03985 (MU539_03975) | - | 813290..816238 (+) | 2949 | WP_257586258.1 | collagen-like protein | - |
| MU539_RS03990 (MU539_03980) | - | 816254..816544 (+) | 291 | WP_257586259.1 | hypothetical protein | - |
| MU539_RS03995 (MU539_03985) | - | 816606..816668 (+) | 63 | WP_225424246.1 | hypothetical protein | - |
| MU539_RS04000 (MU539_03990) | - | 816649..816999 (+) | 351 | WP_225350104.1 | hypothetical protein | - |
| MU539_RS04005 (MU539_03995) | - | 817014..817427 (+) | 414 | WP_032961125.1 | phage holin | - |
| MU539_RS04010 (MU539_04000) | - | 817442..817714 (+) | 273 | WP_032964520.1 | DUF6275 family protein | - |
| MU539_RS04015 (MU539_04005) | - | 817725..818897 (+) | 1173 | WP_257586261.1 | GH25 family lysozyme | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 15924.54 Da Isoelectric Point: 5.7222
>NTDB_id=676618 MU539_RS03810 WP_257586235.1 787364..787801(+) (ssb) [Lacticaseibacillus rhamnosus strain VHProbi M14]
MLNSVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGNRETDFINCVIWTKSAENLAKFTHKGSLIGVEGHIQTR
TYDNAQGNKVYVTEVVVENFALLEPRQTSQESQQRSANNPAAASQGNRFANNGQPIDVSDDDLPF
MLNSVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGNRETDFINCVIWTKSAENLAKFTHKGSLIGVEGHIQTR
TYDNAQGNKVYVTEVVVENFALLEPRQTSQESQQRSANNPAAASQGNRFANNGQPIDVSDDDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=676618 MU539_RS03810 WP_257586235.1 787364..787801(+) (ssb) [Lacticaseibacillus rhamnosus strain VHProbi M14]
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAAGACGTTGACCTTCGCTACACACAAAGCGGAACGGCAGTCGG
TTCATTCACAATCGCTGTTGACCGTCAATTCCGCAGTGCGAACGGTAACCGGGAGACTGACTTCATCAATTGTGTCATCT
GGACTAAGTCAGCTGAGAACCTCGCTAAGTTCACGCATAAGGGTTCACTCATTGGTGTTGAAGGTCACATTCAGACGCGC
ACATACGACAACGCACAAGGCAATAAAGTGTATGTAACTGAGGTCGTTGTCGAGAATTTCGCCTTGCTTGAGCCACGGCA
GACGTCTCAGGAAAGCCAACAACGATCGGCTAATAACCCAGCGGCCGCAAGCCAAGGCAACAGGTTTGCCAACAACGGTC
AGCCAATCGATGTCAGCGATGATGATCTTCCATTCTAA
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAAGACGTTGACCTTCGCTACACACAAAGCGGAACGGCAGTCGG
TTCATTCACAATCGCTGTTGACCGTCAATTCCGCAGTGCGAACGGTAACCGGGAGACTGACTTCATCAATTGTGTCATCT
GGACTAAGTCAGCTGAGAACCTCGCTAAGTTCACGCATAAGGGTTCACTCATTGGTGTTGAAGGTCACATTCAGACGCGC
ACATACGACAACGCACAAGGCAATAAAGTGTATGTAACTGAGGTCGTTGTCGAGAATTTCGCCTTGCTTGAGCCACGGCA
GACGTCTCAGGAAAGCCAACAACGATCGGCTAATAACCCAGCGGCCGCAAGCCAAGGCAACAGGTTTGCCAACAACGGTC
AGCCAATCGATGTCAGCGATGATGATCTTCCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.647 |
100 |
0.676 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.093 |
100 |
0.559 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.268 |
100 |
0.414 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.268 |
100 |
0.414 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.597 |
100 |
0.407 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.597 |
100 |
0.407 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.597 |
100 |
0.407 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.597 |
100 |
0.407 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
52.83 |
73.103 |
0.386 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
37.241 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
31.395 |
100 |
0.372 |