Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | JMUB0001_RS06205 | Genome accession | NZ_AP014956 |
| Coordinates | 1268622..1268933 (+) | Length | 103 a.a. |
| NCBI ID | WP_029625707.1 | Uniprot ID | - |
| Organism | Staphylococcus capitis strain TW2795 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1263622..1273933
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMUB0001_RS06175 (JMUB0001_1208) | - | 1264395..1264598 (+) | 204 | WP_002433937.1 | YqgQ family protein | - |
| JMUB0001_RS06180 (JMUB0001_1209) | - | 1264595..1265581 (+) | 987 | WP_023350198.1 | ROK family glucokinase | - |
| JMUB0001_RS06185 (JMUB0001_1210) | - | 1265581..1265907 (+) | 327 | WP_002433945.1 | MTH1187 family thiamine-binding protein | - |
| JMUB0001_RS06190 (JMUB0001_1211) | - | 1265907..1266530 (+) | 624 | WP_023350199.1 | MBL fold metallo-hydrolase | - |
| JMUB0001_RS06195 (JMUB0001_1212) | comGA | 1266588..1267562 (+) | 975 | WP_049427590.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| JMUB0001_RS06200 | comGB | 1267534..1268603 (+) | 1070 | Protein_1171 | competence type IV pilus assembly protein ComGB | - |
| JMUB0001_RS06205 (JMUB0001_1214) | comGC | 1268622..1268933 (+) | 312 | WP_029625707.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| JMUB0001_RS06210 (JMUB0001_1215) | comGD | 1268911..1269360 (+) | 450 | WP_162488576.1 | competence type IV pilus minor pilin ComGD | - |
| JMUB0001_RS06215 (JMUB0001_1216) | - | 1269347..1269646 (+) | 300 | WP_023350203.1 | hypothetical protein | - |
| JMUB0001_RS06220 (JMUB0001_1217) | comGF | 1269627..1270055 (+) | 429 | WP_231098764.1 | competence type IV pilus minor pilin ComGF | - |
| JMUB0001_RS06230 (JMUB0001_1218) | - | 1270225..1270734 (+) | 510 | WP_336390744.1 | shikimate kinase | - |
| JMUB0001_RS06235 (JMUB0001_1219) | gcvT | 1270943..1272034 (+) | 1092 | WP_037549231.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| JMUB0001_RS06240 (JMUB0001_1220) | gcvPA | 1272053..1273399 (+) | 1347 | WP_037549230.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11345.43 Da Isoelectric Point: 9.7122
>NTDB_id=67545 JMUB0001_RS06205 WP_029625707.1 1268622..1268933(+) (comGC) [Staphylococcus capitis strain TW2795]
MLKKLKKSKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCDAQVKMVNSQIEAYTLKHNRNPNNIEELIAEGFI
KEGQKNCKSGQTISISNGEAVAN
MLKKLKKSKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCDAQVKMVNSQIEAYTLKHNRNPNNIEELIAEGFI
KEGQKNCKSGQTISISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=67545 JMUB0001_RS06205 WP_029625707.1 1268622..1268933(+) (comGC) [Staphylococcus capitis strain TW2795]
ATATTAAAAAAACTAAAAAAATCTAAAGCTTTCACTTTAATTGAAATGTTACTTGTTTTATTAATTATTAGTTTATTACT
TATTTTAATTATACCTAATATTGCCAAACAAACAGCACATATCCAATCTACTGGTTGTGATGCTCAAGTAAAAATGGTAA
ATAGTCAAATTGAAGCATATACATTAAAGCATAATCGTAACCCTAATAATATTGAAGAATTAATTGCTGAAGGTTTTATA
AAAGAAGGACAGAAAAATTGTAAATCCGGACAAACTATTAGTATTTCAAATGGTGAGGCTGTTGCGAACTAA
ATATTAAAAAAACTAAAAAAATCTAAAGCTTTCACTTTAATTGAAATGTTACTTGTTTTATTAATTATTAGTTTATTACT
TATTTTAATTATACCTAATATTGCCAAACAAACAGCACATATCCAATCTACTGGTTGTGATGCTCAAGTAAAAATGGTAA
ATAGTCAAATTGAAGCATATACATTAAAGCATAATCGTAACCCTAATAATATTGAAGAATTAATTGCTGAAGGTTTTATA
AAAGAAGGACAGAAAAATTGTAAATCCGGACAAACTATTAGTATTTCAAATGGTGAGGCTGTTGCGAACTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus N315 |
86.408 |
100 |
0.864 |
| comGC | Staphylococcus aureus MW2 |
86.408 |
100 |
0.864 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
45.631 |
100 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
45.098 |
99.029 |
0.447 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
44.118 |
99.029 |
0.437 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
44.118 |
99.029 |
0.437 |
| comGC/cglC | Streptococcus pneumoniae D39 |
44.118 |
99.029 |
0.437 |
| comGC/cglC | Streptococcus pneumoniae R6 |
44.118 |
99.029 |
0.437 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
48.837 |
83.495 |
0.408 |
| comYC | Streptococcus mutans UA159 |
46.591 |
85.437 |
0.398 |
| comYC | Streptococcus mutans UA140 |
46.591 |
85.437 |
0.398 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
50.633 |
76.699 |
0.388 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |